EY659212

Overview
NameEY659212
Unique NameEY659212
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7466 contig Csv1_Contig7466:1..909. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659212 vs. ExPASy Swiss-Prot
Match: ATPD_TOBAC (ATP synthase delta chain, chloroplastic OS=Nicotiana tabacum GN=ATPD PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.901e-18
Identity = 45/143 (31.47%), Postives = 84/143 (58.74%), Query Frame = 2
Query:  368 ASGYAAALLDKALCHSSLEAVQRDVLKLSRLLKNEQIQAVCADPFVGDKDKGQIVKELLSSWKVNRYLAALLRMLIERNKVAMVSDVLEEFQRIYDDLIGTRVVFVSSAKKMEEDQLFHIAKRVQNLCGAAQVKIRNLIQEGV 796
            A  YA AL D A  + +LE    D+ K+ ++  +E +      P VG++ K ++V E++SS  +  ++A  L +L++  +V ++ ++++EF+++Y+ L  T +  V+S  K+E   L  IAK VQ L G+  V+I+ +I E +
Sbjct:   66 AGSYANALADIAKSNGTLEQTTADLEKIEKISDDEAVFNFFVSPIVGEEKKRELVDEIVSSSSIQPHVANFLNILVDMKRVELIKEIVKEFEKVYNTLTDTELAVVTSVVKLESQHLAQIAKGVQRLTGSKNVRIKTVIDESL 208          
BLAST of EY659212 vs. ExPASy Swiss-Prot
Match: ATPD_SPIOL (ATP synthase delta chain, chloroplastic OS=Spinacia oleracea GN=ATPD PE=1 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 1.862e-17
Identity = 47/139 (33.81%), Postives = 81/139 (58.27%), Query Frame = 2
Query:  368 ASGYAAALLDKALCHSSLEAVQRDVLKLSRLLKNEQIQAVCADPFVGDKDKGQIVKELLSSWKVNRYLAALLRMLIERNKVAMVSDVLEEFQRIYDDLIGTRVVFVSSAKKMEEDQLFHIAKRVQNLCGAAQVKIRNLI 784
            AS YA+AL D A    +LEA   DV KL R+   E +    A+P +   +K  ++ E++++  +  + A  + +LI+  ++ +V ++L EF+ +++ + GT V  V+S  K+E D L  IAK VQ + GA  V+I+ +I
Sbjct:   75 ASRYASALADVADVTGTLEATNSDVEKLIRIFSEEPVYYFFANPVISIDNKRSVLDEIITTSGLQPHTANFINILIDSERINLVKEILNEFEDVFNKITGTEVAVVTSVVKLENDHLAQIAKGVQKITGAKNVRIKTVI 213          
BLAST of EY659212 vs. ExPASy Swiss-Prot
Match: ATPD_PEA (ATP synthase delta chain, chloroplastic OS=Pisum sativum GN=ATPD PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.991e-16
Identity = 45/139 (32.37%), Postives = 80/139 (57.55%), Query Frame = 2
Query:  368 ASGYAAALLDKALCHSSLEAVQRDVLKLSRLLKNEQIQAVCADPFVGDKDKGQIVKELLSSWKVNRYLAALLRMLIERNKVAMVSDVLEEFQRIYDDLIGTRVVFVSSAKKMEEDQLFHIAKRVQNLCGAAQVKIRNLI 784
            A  YAAAL D A  +++L+A+  D  K+ +L  + ++    + P V D  K Q++ E  ++     +    L +LI+  ++ M+ D+++EF+ +Y+ L  T +V V+S  K+E   L  IAK+VQ L GA +V+ + L+
Sbjct:   69 AGSYAAALADLANSNNTLDAITADFDKIEQLFSDPKVFDYFSSPIVEDSTKRQLIGEFATTSGFQPHTHNFLNVLIDSKRIDMIIDIIKEFEFVYNTLTDTELVVVTSVVKLESHHLAQIAKQVQKLTGAKKVRTKTLL 207          
BLAST of EY659212 vs. ExPASy Swiss-Prot
Match: ATPD_CHLRE (ATP synthase delta chain, chloroplastic OS=Chlamydomonas reinhardtii GN=ATPD PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.635e-13
Identity = 42/144 (29.17%), Postives = 83/144 (57.64%), Query Frame = 2
Query:  368 ASGYAAALLDKALCHSSLEAVQRDVLKLSRLLK-NEQIQAVCADPFVGDKDKGQIVKELLSSWKVNRYLAALLRMLIERNKVAMVSDVLEEFQRIYDDLIGTRVVFVSSAKKMEEDQLFHIAKRVQNLCGAAQVKIRNLIQEGV 796
            +  YA AL++ A     LEAV  DV  ++ L+K N ++ A+  +P V    K  ++ ++       +Y    L +L+E++++++V ++ E F+ +Y  +  T+V  + SA K+E++Q F IAK++Q L G+  +K++ +I   +
Sbjct:   39 SESYAKALVELADEKGKLEAVHADVDAVAGLMKENAKLSALIMNPVVESDKKRAVLAKIAKEAGFQQYTINWLNLLVEKDRLSLVPEICECFEDLYCQMTDTQVATLRSAVKLEQEQQFLIAKKLQELTGSKNIKLKPVIDSSL 182          
The following BLAST results are available for this feature:
BLAST of EY659212 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
ATPD_TOBAC4.901e-1831.47ATP synthase delta chain, chloroplastic OS=Nicotia... [more]
ATPD_SPIOL1.862e-1733.81ATP synthase delta chain, chloroplastic OS=Spinaci... [more]
ATPD_PEA5.991e-1632.37ATP synthase delta chain, chloroplastic OS=Pisum s... [more]
ATPD_CHLRE3.635e-1329.17ATP synthase delta chain, chloroplastic OS=Chlamyd... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659212 ID=EY659212|Name=EY659212|organism=Citrus sinensis|type=EST|length=909bp
CGGNATTCACGGCCTCGACCCACGCGTCCGTTCCTCTTCACCCAACCCAA
GGCCAACGGACAAACGTTTGGTTTCTTCCATCCGCAATTTTGTATCCATG
GATACTCTTTCAAGCTCGGTTTCCACCTTCAAATTTGCAGCTCTTCACTC
AACACCTCGAGAATTACATAACTTCAAAGCTCCTCCAAACACATCCCAAT
CTCATCATCAGTTTCATCCACACCAGTCCCACCTCAGCTCAACCAGACCC
AACAAAACTGCCGCTTCTTTCACTCGCAGGAGCTTCTCTAATAGTTATCC
ATCGTTAATTTCCTCCTCCGGAACCTCAACTCCCAAGTCAGCTTCCCCAA
ATAGCCATCAGAAACCTGCCAGCGGCTACGCTGCAGCCCTTCTAGACAAA
GCTCTATGCCACAGTTCACTTGAAGCTGTCCAAAGGGATGTCCTAAAGTT
ATCAAGGTTGCTCAAGAATGAGCAAATTCAAGCTGTCTGTGCTGACCCTT
TTGTGGGTGATAAAGACAAGGGGCAAATAGTGAAGGAACTGTTGAGTAGT
TGGAAAGTTAATAGGTATTTGGCGGCTCTGCTGAGGATGCTGATTGAGAG
AAATAAGGTGGCCATGGTGAGTGATGTTTTGGAGGAATTTCAGAGGATCT
ATGACGACTTGATTGGGACTCGAGTTGTGTTTGTTTCGTCTGCAAAGAAG
ATGGAGGAAGATCAACTCTTTCATATTGCTAAGAGAGTTCAAAACCTTTG
TGGGGCTGCACAAGTCAAGATTAGAAATTTGATTCAGGAGGGAGTGCCAT
CCTATCCTTAATCATGTNCATTNGCATTNATAGAGCTGACGCAACGGNTA
TGNTGCTGNATAACTAAANGATGTGNNATCTCAACAAGNTACCTTNACAG
TCCTACACA
back to top