EY659197

Overview
NameEY659197
Unique NameEY659197
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length958
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659197_ssr267 microsatellite EY659197_ssr267:267..278. BLAST: Citrus ESTs to Prunus persica proteins V1
EY659197_ssr279 microsatellite EY659197_ssr279:279..290. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659197 vs. ExPASy Swiss-Prot
Match: CB4A_SOLLC (Chlorophyll a-b binding protein CP24 10A, chloroplastic OS=Solanum lycopersicum GN=CAP10A PE=3 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 6.022e-38
Identity = 88/160 (55.00%), Postives = 101/160 (63.12%), Query Frame = 1
Query:  364 SLPCDYGFDPLGLGKDPAFLKWDR*A*LIHGRWAMAAVVGIFRGQAWSGIPWFQAGADPGALSPFSLAHFLEPTFSLWVGLKSNRWGGFFSSLNPNQVELGTPLATNWWKPFPMRLAN----KGYPGGKVFESLXVAWTIKGGGLSFPALENLPGLKLLE 831
            SLP DYGFDPLGLGKDPAFLKW R A LIHGRWAMAAV+GIF GQAWSGIPWF+AGADPGA++PFS    L     L   ++S RW  FF   +   VE  TP     W       AN    +GYPGGK F+ L +A T+   G+  P  E L  LK+ E
Sbjct:   74 SLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGTLLGTQLILMGWVESKRWVDFFDP-DSQSVEWATP-----WSKTAENFANFTGEQGYPGGKFFDPLALAGTL-NNGVYVPDTEKLERLKVAE 226          
BLAST of EY659197 vs. ExPASy Swiss-Prot
Match: CB4B_SOLLC (Chlorophyll a-b binding protein CP24 10B, chloroplastic OS=Solanum lycopersicum GN=CAP10B PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.027e-37
Identity = 86/160 (53.75%), Postives = 102/160 (63.75%), Query Frame = 1
Query:  364 SLPCDYGFDPLGLGKDPAFLKWDR*A*LIHGRWAMAAVVGIFRGQAWSGIPWFQAGADPGALSPFSLAHFLEPTFSLWVGLKSNRWGGFFSSLNPNQVELGTPLATNWWKPFPMRLAN----KGYPGGKVFESLXVAWTIKGGGLSFPALENLPGLKLLE 831
            SLP D+GFDPLGLGKDPAFLKW R A LIHGRWAMAAV+GIF GQAWSGIPWF+AGADPGA++PFS    L     L   ++S RW  FF + +   ++  TP     W       AN    +GYPGGK F+ L +A T+   G+  P  E L  LKL E
Sbjct:   74 SLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDN-DSQSIDWATP-----WSKTAENFANFTGEQGYPGGKFFDPLALAGTL-NNGVYVPDTEKLERLKLAE 226          
BLAST of EY659197 vs. ExPASy Swiss-Prot
Match: CB4_SPIOL (Chlorophyll a-b binding protein CP24, chloroplastic OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.937e-36
Identity = 84/156 (53.85%), Postives = 100/156 (64.10%), Query Frame = 1
Query:  364 SLPCDYGFDPLGLGKDPAFLKWDR*A*LIHGRWAMAAVVGIFRGQAWSGIPWFQAGADPGALSPFSLAHFLEPTFSLWVGLKSNRWGGFFSSLNPNQVELGTPLATNWWKPFPMRLANKGYPGGKVFESLXVAWTIKGGGLSFPALENLPGLKLLE 831
            SLP D+GFDPLGLGKDPAFLKW R A LIHGRWAM AV+GIF GQAW+GIPWF+AGADPGA++PFS    L     L   ++S RW  FF   +   VE  TP +    + F      +GYPGGK F+ L +A TI  G  + P  + L  LKL E
Sbjct:   79 SLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMLAVLGIFVGQAWTGIPWFEAGADPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFDP-DSQSVEWATPWSRT-AENFSNSTGEQGYPGGKFFDPLSLAGTISNGVYN-PDTDKLERLKLAE 231          
The following BLAST results are available for this feature:
BLAST of EY659197 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
CB4A_SOLLC6.022e-3855.00Chlorophyll a-b binding protein CP24 10A, chloropl... [more]
CB4B_SOLLC1.027e-3753.75Chlorophyll a-b binding protein CP24 10B, chloropl... [more]
CB4_SPIOL1.937e-3653.85Chlorophyll a-b binding protein CP24, chloroplasti... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-E02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659197 ID=EY659197|Name=EY659197|organism=Citrus sinensis|type=EST|length=958bp
TTCAAAGAACGGACCCACGCGTCCGAGGATGACTTTTTCTAAAAATCAGT
TGGTGTATCTCGCTCTTCCACCTAAAAAATCTTGGATTCCTGCTGTTAAA
GGTGGTGGCAACCTCATTAATCCCGAATGGCTCGATGGCTCGTAAGTATT
CTCTCTATCTAATCTATTCTTTGCTTGGTTAATAATACATCATATGTCTC
GTCGGCCTCAAATACAACTAACTCAAACTCATGTTAGAACAGTGCCTAAA
CGCCGAACAAGCTAAGAATCAATCAATCTATCTATCTATCCTTCTTGTTT
TTTCTCACATTTTAATATTCTACCATATAACTTCGTGCGCGTCTGGGGCG
TGTCTGTGTGTTTAGTCTCCCATGTGACTACGGATTCGACCCACTTGGGC
TTGGAAAGGACCCAGCATTCCTGAAATGGGACAGATAAGCATAACTGATC
CACGGACGATGGGCAATGGCTGCAGTTGTTGGGATATTCCGCGGACAGGC
GTGGAGTGGGATTCCCTGGTTCCAGGCTGGAGCAGATCCTGGAGCCCTAT
CACCCTTCTCCTTGGCTCACTTCCTGGAACCCACCTTCTCCTTATGGGTT
GGGTTGAAAAGCAACCGGTGGGGTGGATTTTTTTCATCCCTGAATCCTAA
TCAAGTTGAATTGGGCACACCCTTGGCGACAAACTGGTGGAAACCTTTCC
CAATGCGACTTGCGAACAAAGGCTACCCTGGGGGAAAAGTTTTTGAATCC
CTATTNGTTGCCTGGACAATTAAAGGAGGGGGGCTCTCCTTCCCTGCCCT
CGAAAACTTGCCAGGCCTTAAGTTGCTAGAATATACAATCGTAGCCTTGC
TAGGGGGCCCTGTTTGTTTTCTCACTTGAAAGCGCCGCAAGGCAAAACCC
ACTCGGGGCTTTGGGTGCGCAAACTAGCTTTGGGTATATCGACCGATAGG
GGAAAAAA
back to top