EY659078

Overview
NameEY659078
Unique NameEY659078
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length874
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659078 vs. ExPASy Swiss-Prot
Match: Y1480_ARATH (Uncharacterized protein At1g18480 OS=Arabidopsis thaliana GN=At1g18480 PE=2 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 6.484e-89
Identity = 153/222 (68.92%), Postives = 188/222 (84.68%), Query Frame = 3
Query:   12 DFRYATEMGLKEFEDWANWYCIGNKMKSLCVGLEKPKDFFSGIPLAFKSMAKEYHNGVRARIAALRPDGPIARRFLSENTTVLVVGDSVFVHGGLLKQHVEYGLERINREVRDWINGLM-GKSAPGYCKGRHAVVWLRKFSDE-EKKCDCSALEHALATIPGVKRMIMGHTIQEKGINAVCDNRAIRIDVGLSRGCYDGLPEVLEINGNSXVLVLTANPLYQ 671
            DFRY T+ GL+EF+ WA+WYC+GNKMK+LC GL+KPKD + GIP++F  M  +   G+RARIAALRPDGPIA+RFL++N TV VVGDSVFVHGGLL +H+EYGLERIN EVR WING   G+ AP YC+G ++VVWLRKFS+E   KCDC+ALEHAL+TIPGVKRMIMGHTIQ+ GIN VC+++AIRIDVG+S+GC DGLPEVLEI  +S V ++T+NPLY+
Sbjct:  141 DFRYVTKKGLEEFQIWADWYCLGNKMKTLCSGLDKPKDPYEGIPMSFPRMRADCFEGIRARIAALRPDGPIAKRFLTKNQTVAVVGDSVFVHGGLLAEHIEYGLERINEEVRGWINGFKGGRYAPAYCRGGNSVVWLRKFSEEMAHKCDCAALEHALSTIPGVKRMIMGHTIQDAGINGVCNDKAIRIDVGMSKGCADGLPEVLEIRRDSGVRIVTSNPLYK 362          
The following BLAST results are available for this feature:
BLAST of EY659078 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y1480_ARATH6.484e-8968.92Uncharacterized protein At1g18480 OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-B07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659078 ID=EY659078|Name=EY659078|organism=Citrus sinensis|type=EST|length=874bp
CCACGCGTCCGGATTTTAGATATGCTACTGAAATGGGTTTAAAAGAGTTT
GAGGATTGGGCTAATTGGTATTGTATTGGCAACAAAATGAAATCTTTATG
TGTAGGGTTAGAAAAGCCGAAAGATTTCTTTAGTGGGATTCCTTTAGCTT
TTAAGAGTATGGCTAAAGAGTATCATAATGGTGTTAGGGCTAGAATTGCT
GCATTGAGACCGGATGGACCGATTGCAAGGCGGTTTTTGTCTGAGAATAC
AACCGTGCTAGTAGTTGGGGACTCTGTTTTTGTTCATGGAGGGTTGTTGA
AGCAACACGTAGAATATGGTTTGGAGAGGATTAATCGAGAAGTGAGGGAC
TGGATCAATGGGTTAATGGGGAAGTCTGCGCCAGGATATTGTAAAGGGAG
GCATGCTGTTGTTTGGTTGAGGAAGTTTTCGGATGAGGAGAAGAAATGTG
ATTGTTCAGCTCTTGAACATGCTCTTGCGACTATTCCTGGCGTGAAGAGA
ATGATTATGGGTCATACGATACAGGAAAAGGGGATAAATGCTGTTTGTGA
TAATAGAGCAATAAGAATTGATGTGGGCTTGTCAAGGGGATGCTATGATG
GGTTGCCTGAGGTCTTGGAGATTAATGGAAATTCTGANGTGCTTGTTTTG
ACAGCGAATCCATTGTATCAGAACAAGACAAAGTTTATTTGGCTCCTGAT
AGCAGGAAGGGCTTGGTTTGTGCTCCCAAATTCGAGCCAAAACAAGTGGA
GTGAAAGCTAATGGGTTGACATCATCCCTTGCAAAAGACTCAAGTTCTCT
CTGATATATATCTTTTGCAGGTAGCTAGTAGATAACCATTGATGAACCTG
ATATATGTCTGTAAATTGTTGAAC
back to top