EY659073

Overview
NameEY659073
Unique NameEY659073
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length915
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659073_ssr46 microsatellite EY659073_ssr46:46..69. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659073 vs. ExPASy Swiss-Prot
Match: IFRH_SOLTU (Isoflavone reductase homolog OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 5.059e-79
Identity = 157/230 (68.26%), Postives = 181/230 (78.70%), Query Frame = 1
Query:  112 ASILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTVSGPSKSQLLDHFKNLGVKIVVGDVLNHESLVKAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVKRFFPSEFGNDVDRVHGAVEPTKSTYDVKAKIRRAVEAEGIPYTYVESYFFDGYFPPNLXQPGATAPPRDKVVIFGDGNPKXYTGR--*Y*TYTIKAXDDPRTLNKNLTFSLPEYLL-INDLGXLGEKR 792
            + IL IGGTGYIGKFIVEAS KAGH TFVLVREST+S P+K++L+D FK+ GV  V GD+ +HESLVKAIKQVDVVISTVGHALLADQVK+IAAIKEAGNVKRFFPSEFGNDVDRVH AVEP K+ ++ KA+IRR VEAEGIP+TYV ++FF GY  PNL QPGA  PP DKVVI G GN K    +     TYTI A DDP+TLNK L    P  ++ +N+L  L EK+
Sbjct:    5 SKILFIGGTGYIGKFIVEASAKAGHDTFVLVRESTLSNPTKTKLIDTFKSFGVTFVHGDLYDHESLVKAIKQVDVVISTVGHALLADQVKLIAAIKEAGNVKRFFPSEFGNDVDRVH-AVEPAKAAFNTKAQIRRVVEAEGIPFTYVATFFFAGYSLPNLAQPGAAGPPNDKVVILGHGNTKAVFNKEEDIGTYTINAVDDPKTLNKILYIKPPHNIITLNELVSLWEKK 233          
BLAST of EY659073 vs. ExPASy Swiss-Prot
Match: IFRH_TOBAC (Isoflavone reductase homolog A622 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 6.853e-68
Identity = 139/235 (59.15%), Postives = 166/235 (70.64%), Query Frame = 1
Query:  100 VSEMASILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTVSGPSKSQLLDHFKNLGVKIVVGDVLNHESLVKAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVKRFFPSEFGNDVDRVHGAVEPTKSTYDVKAKIRRAVEAEGIPYTYVESYFFDGYFPPNLXQPGATAPPRDKVVIFGDGNPK--XYTGR*Y*TYTIKAXDDPRTLNKNLTFSLPEYLL-INDLGXLGEKRL 795
            VSE + IL IGGTGYIGK++VE S K+GHPTF L+REST+  P KS+L+D FK+ GV ++ GD+ N ESL+KAIKQVDVVISTVG     DQV II AIKEAGN+KRF PSEFG DVD    A+EP  S + +K +IRR +EAEGIPYTYV   +F  +F PNL Q  A  PPRDKVVIFGDGNPK          TYTI+A DDPRTLNK L    P  +L  N++  L E ++
Sbjct:    3 VSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVTLLFGDISNQESLLKAIKQVDVVISTVGGQQFTDQVNIIKAIKEAGNIKRFLPSEFGFDVDHAR-AIEPAASLFALKVRIRRMIEAEGIPYTYVICNWFADFFLPNLGQLEAKTPPRDKVVIFGDGNPKAIYVKEEDIATYTIEAVDDPRTLNKTLHMRPPANILSFNEIVSLWEDKI 236          
BLAST of EY659073 vs. ExPASy Swiss-Prot
Match: IFRH_ARATH (Isoflavone reductase homolog P3 OS=Arabidopsis thaliana GN=At1g75280 PE=1 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 2.879e-66
Identity = 142/236 (60.17%), Postives = 167/236 (70.76%), Query Frame = 1
Query:  103 SEMASILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTVSGPSKSQLLDHFKNLGVKIVVGDVLNHESLVKAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVKRFFPSEFGNDVDRVHGAVEPTKSTYDVKAKIRRAVEAEGIPYTYVESYFFDGYFPPNLXQ--PGATAPPRDKVVIFGDGNPKXYTGR--*Y*TYTIKAXDDPRTLNKNLTFSLPEYLL-INDLGXLGEKRL 795
            +E + IL IGGTGYIGKF+VEAS KAGH TF LVRE+T+S P K + +  FK+LGV I+ GD+ +HESLVKAIKQVDVVISTVG   + DQ KII+AIKEAGNVKRF PSEFG DVDR   AVEP KS +  K +IRR +EAEGIPYTY  +  F GY+ P L Q  PG T+PPRDKV I GDGN K    +      YTIKA DDPRTLNK L        L +N++  L EK++
Sbjct:    3 TEKSKILVIGGTGYIGKFLVEASAKAGHSTFALVREATLSDPVKGKTVQSFKDLGVTILHGDLNDHESLVKAIKQVDVVISTVGSMQILDQTKIISAIKEAGNVKRFLPSEFGVDVDRT-SAVEPAKSAFAGKIQIRRTIEAEGIPYTYAVTGCFGGYYLPTLVQFEPGLTSPPRDKVTILGDGNAKAVINKEEDIAAYTIKAVDDPRTLNKILYIKPSNNTLSMNEIVTLWEKKI 237          
BLAST of EY659073 vs. ExPASy Swiss-Prot
Match: IFR_CICAR (Isoflavone reductase OS=Cicer arietinum GN=IFR PE=1 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.530e-59
Identity = 131/240 (54.58%), Postives = 162/240 (67.50%), Query Frame = 1
Query:  118 ILSIGGTGYIGKFIVEASVKAGHPTFVLVRES-----------TVSGPSKSQLLDHFKNLGVKIVVGDVLNHESLVKAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVKRFFPSEFGNDVDRVHGAVEPTKSTYDVKAKIRRAVEAEGIPYTYVESYFFDGYFPPNLXQPGATAPPRDKVVIFGDGNPK--XYTGR*Y*TYTIKAXDDPRTLNKNLTFSLP-EYLLINDLGXLGEKRL 795
            IL +G TG IG+ +V AS+KAG+PT+ L+R++             +  SK +LL  FK  GV ++ GD+ +HE+LVKAIKQVD VI T G  L+ DQVKII AIKEAGNVKRFFPSEFG DVDR H AV+P +  +D KA IRR VEAEG+PYTY+  + F GYF  NL Q  AT PPRDKV+I GDGN K    T     TYTI+A +DPRTLNK +   LP  YL  N++  L EK++
Sbjct:    7 ILVLGPTGAIGRHVVWASIKAGNPTYALIRKTPGDINKPSLVAAANPESKEELLQSFKAAGVILLEGDMNDHEALVKAIKQVDTVICTFGRLLILDQVKIIKAIKEAGNVKRFFPSEFGLDVDR-HDAVDPVRPVFDEKASIRRVVEAEGVPYTYLCCHAFTGYFLRNLAQFDATEPPRDKVIILGDGNVKGAYVTEADVGTYTIRAANDPRTLNKAVHIRLPHNYLTSNEVVSLWEKKI 245          
BLAST of EY659073 vs. ExPASy Swiss-Prot
Match: IFR_MEDSA (Isoflavone reductase OS=Medicago sativa GN=IFR PE=1 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 3.409e-59
Identity = 129/240 (53.75%), Postives = 167/240 (69.58%), Query Frame = 1
Query:  118 ILSIGGTGYIGKFIVEASVKAGHPTFVLVRES----------TVSGP-SKSQLLDHFKNLGVKIVVGDVLNHESLVKAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVKRFFPSEFGNDVDRVHGAVEPTKSTYDVKAKIRRAVEAEGIPYTYVESYFFDGYFPPNLXQPGATAPPRDKVVIFGDGNPK--XYTGR*Y*TYTIKAXDDPRTLNKNLTFSLPE-YLLINDLGXLGEKRL 795
            IL +G TG IG+ IV AS+KAG+PT+ LVR++          T + P +K +L+D++++LGV ++ GD+ +HE+LVKAIKQVD+VI   G  L+ DQVKII AIKEAGNVK+FFPSEFG DVDR H AVEP +  ++ KA IRR +EAEG+PYTY+  + F GYF  NL Q   T PPRDKVVI GDGN K    T     T+TI+A +DP TLNK +   LPE YL  N++  L EK++
Sbjct:    7 ILILGPTGAIGRHIVWASIKAGNPTYALVRKTPGNVNKPKLITAANPETKEELIDNYQSLGVILLEGDINDHETLVKAIKQVDIVICAAGRLLIEDQVKIIKAIKEAGNVKKFFPSEFGLDVDR-HEAVEPVRQVFEEKASIRRVIEAEGVPYTYLCCHAFTGYFLRNLAQLDTTDPPRDKVVILGDGNVKGAYVTEADVGTFTIRAANDPNTLNKAVHIRLPENYLTQNEVIALWEKKI 245          
BLAST of EY659073 vs. ExPASy Swiss-Prot
Match: IFR_PEA (Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 5.443e-57
Identity = 127/240 (52.92%), Postives = 163/240 (67.92%), Query Frame = 1
Query:  118 ILSIGGTGYIGKFIVEASVKAGHPTFVLVREST--VSGP---------SKSQLLDHFKNLGVKIVVGDVLNHESLVKAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVKRFFPSEFGNDVDRVHGAVEPTKSTYDVKAKIRRAVEAEGIPYTYVESYFFDGYFPPNLXQPGATAPPRDKVVIFGDGNPK--XYTGR*Y*TYTIKAXDDPRTLNKNLTFSLP-EYLLINDLGXLGEKRL 795
            IL +G TG IG+ IV AS+KAG+PT+ LVR+++  V+ P         +K +LL +++  GV ++ GD+ +HE+LV AIKQVD VI   G  L+ DQVK+I AIKEAGNVKRFFPSEFG DVDR H AVEP +  ++ KA IRR VE+EG+PYTY+  + F GYF  NL Q  AT PPRDKVVI GDGN +    T     TYTI+A +DP TLNK +   LP  YL  N++  L EK++
Sbjct:    7 ILILGATGAIGRHIVWASIKAGNPTYALVRKTSDNVNKPKLTEAANPETKEELLKNYQASGVILLEGDINDHETLVNAIKQVDTVICAAGRLLIEDQVKVIKAIKEAGNVKRFFPSEFGLDVDR-HDAVEPVRQVFEEKASIRRVVESEGVPYTYLCCHAFTGYFLRNLAQIDATDPPRDKVVILGDGNVRGAYVTEADVGTYTIRAANDPNTLNKAVHIRLPNNYLTANEVIALWEKKI 245          
BLAST of EY659073 vs. ExPASy Swiss-Prot
Match: IFRH_MAIZE (Isoflavone reductase homolog IRL OS=Zea mays GN=IRL PE=2 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 3.091e-52
Identity = 118/241 (48.96%), Postives = 149/241 (61.83%), Query Frame = 1
Query:  103 SEMASILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTVSGPSKSQLLDHFKNLGVKIVVGDVLNHESLVKAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVKRFFPSEFGNDVDRVHGAVEPTKSTYDVKAKIRRAVEAEGIPYTYVESYFFDGYFPPNLXQPGATAPPRDKVVIFGDGNPK--XYTGR*Y*TYTIKAXDDPRTLNKNLTFSLPEYLLI-NDLGXLGEKRLANPXKGE 816
            SE + IL +GGTGY+G+ +V AS + GHPT  LVR++  S P+K+ LL  F++ GV ++ GD+ +  SLV A+K  DVVIS +G   +ADQ +++ AIKEAGNVKRFFPSEFG DVDR  G VEP KS    K  IRRA EA GIPYTY  + FF G+  P + Q  A  PP DK V+ GDG+ K          TYT+ A DDPR  NK L    P   L  N+L  L EK+     + E
Sbjct:    3 SEKSKILVVGGTGYLGRHVVAASARLGHPTSALVRDTAPSDPAKAALLKSFQDAGVTLLKGDLYDQASLVSAVKGADVVISVLGSMQIADQSRLVDAIKEAGNVKRFFPSEFGLDVDRT-GIVEPAKSILGAKVGIRRATEAAGIPYTYAVAGFFAGFGLPKVGQVLAPGPPADKAVVLGDGDTKAVFVEEGDIATYTVLAADDPRAENKVLYIKPPANTLSHNELLSLWEKKTGKTFRRE 242          
BLAST of EY659073 vs. ExPASy Swiss-Prot
Match: IFRH_LUPAL (Isoflavone reductase homolog OS=Lupinus albus PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.643e-45
Identity = 103/224 (45.98%), Postives = 138/224 (61.61%), Query Frame = 1
Query:  112 ASILSIGGTGYIGKFIVEASVKAGHPTFVLVRESTVSGPSKSQLLDHFKNLGVKIVVGDVLNHESLVKAIKQVDVVISTVG------HALLADQVKIIAAIKEAGNVKRFFPSEFGNDVDRVHGAVEPTKSTYDVKAKIRRAVEAEGIPYTYVESYFFDGYFPPNLXQPGATAPPRDKVVIFGDGN--PKXYTGR*Y*TYTIKAXDDPRTLNKNLTFSLPEYLL 759
            + +L +GGTGY+G+ IV+AS++ GH TF+L R        K Q+L  FK  G  +V     +H+SLV A+K VDVVI T+       H LL  Q+K++ AIK+AGN+KRF PSEFG D   +  A+EP + T+D K  +R+A+E   IP+TY+ +  F GYF  NL Q     PPRDKV+++GDGN  P         TYTIK  DDPRTLNK +    PE +L
Sbjct:    4 SKVLVVGGTGYVGRRIVKASLEHGHETFILQRPEIGLDIEKLQILLSFKKQGAILVEASFSDHKSLVDAVKLVDVVICTMSGVHFRSHNLLT-QLKLVEAIKDAGNIKRFLPSEFGMDPALMGHALEPGRVTFDEKMTVRKAIEEANIPFTYISANCFAGYFAGNLSQMKTLLPPRDKVLLYGDGNVKPVYMDEDDVATYTIKTIDDPRTLNKTVYLRPPENIL 226          
BLAST of EY659073 vs. ExPASy Swiss-Prot
Match: IGS1_PETHY (Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 5.468e-41
Identity = 97/217 (44.70%), Postives = 132/217 (60.83%), Query Frame = 1
Query:  118 ILSIGGTGYIGKFIVEASVKAGHPTFVLVRE-STVSGPSKSQLLDHFKNLGVKIVVGDVLNHESLVKAIKQVDVVISTVGHALLADQVKIIAAIKEAGNVKRFFPSEFGNDVDRVHGAVEPTKSTYDVKAKIRRAVEAEGIPYTYVESYFFDGYFPPNLXQPGATAPPRDKVVIFGDGNPKXYTG--R*Y*TYTIKAXDDPRTLNKNLTFSLPEYLL 759
            IL +G TGY+GK++V+AS+  GHPT+  V      S  SK QLL  F++LGV I  G++  H+ LV   K+VD+VIST+      +Q+K+I AIKEAGN+KRF PSEFGN+VDRV  A+   ++  D K KIRRA EA GIP+T+V +     YF   L  P   +   ++V I+G G+ K           YTIKA DDPR  N+ L    P+ ++
Sbjct:    8 ILILGATGYLGKYMVKASISLGHPTYAYVMPLKKNSDDSKLQLLKEFESLGVTIFYGELSEHDKLVAVFKEVDIVISTLAVPQYLEQLKVIEAIKEAGNIKRFVPSEFGNEVDRVR-ALPRFQAVLDNKKKIRRATEAAGIPFTFVSANSLTAYFVDYLLHPRQKS---EQVTIYGSGDAKAVLNYEEDVAAYTIKAADDPRAANRVLIIKPPKNIV 220          
BLAST of EY659073 vs. ExPASy Swiss-Prot
Match: LAR_DESUN (Leucoanthocyanidin reductase OS=Desmodium uncinatum GN=LAR PE=1 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.759e-39
Identity = 99/230 (43.04%), Postives = 138/230 (60.00%), Query Frame = 1
Query:  121 LSIGGTGYIGKFIVEASVKAGHPTFVLVRESTVSGPSKSQLLDHFKNLGVKIVVGDVLNHESLVKAIKQ--VDVVISTVGHALLADQVKIIAAIKEAGNVKRFFPSEFGNDVDRVHGAVEPTKSTYDVKAKIRRAVEAEGIPYTYVESYFFDGYFPPNLXQPGATAPPRDKVVIFGDGNPKXY--TGR*Y*TYTIKAXDDPRTLNKNLTF-SLPEYLLINDLGXLGEKRL 795
            L +GGTG+IG+FI +AS+  G+PTF+LVR   VS PSK+ ++  F++ G K++ G + + E + K +K+  +DVVIS VG A L DQ+ ++ AIK    +KRF PSEFG+DVDR    VEP  + Y  K  +RRAVE  GIP+T +       +   +   P    PP D+  I+GDGN K Y   G     +T+K  DD RTLNKN+ F        IN+L  L EK++
Sbjct:   16 LVVGGTGFIGQFITKASLGFGYPTFLLVRPGPVS-PSKAVIIKTFQDKGAKVIYGVINDKECMEKILKEYEIDVVISLVGGARLLDQLTLLEAIKSVKTIKRFLPSEFGHDVDRT-DPVEPGLTMYKEKRLVRRAVEEYGIPFTNICCNSIASWPYYDNCHPSQVPPPMDQFQIYGDGNTKAYFIDGNDIGKFTMKTIDDIRTLNKNVHFRPSSNCYSINELASLWEKKI 243          
The following BLAST results are available for this feature:
BLAST of EY659073 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
IFRH_SOLTU5.059e-7968.26Isoflavone reductase homolog OS=Solanum tuberosum ... [more]
IFRH_TOBAC6.853e-6859.15Isoflavone reductase homolog A622 OS=Nicotiana tab... [more]
IFRH_ARATH2.879e-6660.17Isoflavone reductase homolog P3 OS=Arabidopsis tha... [more]
IFR_CICAR1.530e-5954.58Isoflavone reductase OS=Cicer arietinum GN=IFR PE=... [more]
IFR_MEDSA3.409e-5953.75Isoflavone reductase OS=Medicago sativa GN=IFR PE=... [more]
IFR_PEA5.443e-5752.92Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 ... [more]
IFRH_MAIZE3.091e-5248.96Isoflavone reductase homolog IRL OS=Zea mays GN=IR... [more]
IFRH_LUPAL1.643e-4545.98Isoflavone reductase homolog OS=Lupinus albus PE=2... [more]
IGS1_PETHY5.468e-4144.70Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 P... [more]
LAR_DESUN1.759e-3943.04Leucoanthocyanidin reductase OS=Desmodium uncinatu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-B01-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659073 ID=EY659073|Name=EY659073|organism=Citrus sinensis|type=EST|length=915bp
CCACGCGTCCGGCTTCCTATACAAGGCGCCGGTATCATTTCATTCAATAA
TAATAATAATAATAATAATAAACAAACTCTCCGGAATTGAACTGAACGAG
TTTCAGAAATGGCATCGATTCTATCCATCGGCGGGACAGGGTATATCGGT
AAATTCATCGTGGAAGCAAGCGTGAAAGCCGGCCACCCGACGTTCGTGCT
CGTGAGGGAATCCACAGTCTCAGGTCCTTCCAAATCTCAGCTCCTCGACC
ACTTCAAAAACCTCGGCGTCAAAATCGTTGTCGGAGATGTTTTGAATCAC
GAGAGTTTGGTGAAGGCGATAAAACAAGTGGACGTGGTGATATCGACAGT
CGGTCACGCTTTATTAGCCGATCAGGTCAAGATTATTGCTGCCATTAAAG
AAGCCGGTAACGTTAAGAGATTCTTCCCATCGGAATTTGGAAATGATGTT
GATCGAGTCCATGGCGCCGTGGAGCCAACAAAATCGACGTATGACGTAAA
GGCGAAAATCCGCCGAGCCGTTGAGGCAGAAGGCATTCCGTACACTTACG
TAGAATCTTATTTTTTTGATGGCTACTTCCCTCCTAATTTGNTGCAGCCT
GGGGCCACTGCCCCCCCTAGGGATAAGGTTGTCATCTTCGGCGATGGAAA
TCCAAAGNNTTATACAGGAAGATGATATTGAACCTACACTATCAAAGCAG
NTGATGATCCGAGAACCTTGAACAAAAACCTTACATTCAGCCTCCCGGAA
TATTTACTCATCAATGATCTAGGGNCTCTGGGGGAGAAAAGATTGGCAAA
CCCCCNAAAGGGAGAATGTTCAAAGGGACACTCCTAAAGATTATCAAGAG
CTGCACCTCCCCACGAGGGAATAATCAATTATCCTCTGCTTTCGGAGGGA
GTCAACCACCTCAGT
back to top