EY659063

Overview
NameEY659063
Unique NameEY659063
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length912
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659063 vs. ExPASy Swiss-Prot
Match: GCP3_XENLA (Gamma-tubulin complex component 3 homolog OS=Xenopus laevis GN=tubgcp3 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.176e-11
Identity = 37/100 (37.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:   36 CQVLWDEMNHFVTNLQYYIMFEVLEVSWSNFSNEMEXXXXXXXXXXXHEKYLHSIFEKSLLGERSQSLFKSLFVLFDLILRFRSHADRLYE-GIRELQAR 332
            C +L  EM HF+  +QYYI FEVLE SW    N++            H+ +L +I  + LL   S++L   L  +FD I+ F++  D LY   + ELQ R
Sbjct:  703 CHILASEMVHFIHQMQYYITFEVLECSWDELWNKVLKAQDLDHIIAAHDVFLDTIISRCLLDSESRALLNQLRAVFDQIIEFQNAQDALYRAALEELQQR 802          
BLAST of EY659063 vs. ExPASy Swiss-Prot
Match: GCP3_HUMAN (Gamma-tubulin complex component 3 OS=Homo sapiens GN=TUBGCP3 PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 2.005e-11
Identity = 36/100 (36.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:   36 CQVLWDEMNHFVTNLQYYIMFEVLEVSWSNFSNEMEXXXXXXXXXXXHEKYLHSIFEKSLLGERSQSLFKSLFVLFDLILRFRSHADRLYE-GIRELQAR 332
            C +L  EM HF+  +QYYI FEVLE SW    N+++           HE +L +I  + LL   S++L   L  +FD I+  ++  D +Y   + ELQ R
Sbjct:  704 CHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAAHEVFLDTIISRCLLDSDSRALLNQLRAVFDQIIELQNAQDAIYRAALEELQRR 803          
BLAST of EY659063 vs. ExPASy Swiss-Prot
Match: GCP3_MOUSE (Gamma-tubulin complex component 3 OS=Mus musculus GN=Tubgcp3 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 4.467e-11
Identity = 36/100 (36.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query:   36 CQVLWDEMNHFVTNLQYYIMFEVLEVSWSNFSNEMEXXXXXXXXXXXHEKYLHSIFEKSLLGERSQSLFKSLFVLFDLILRFRSHADRLYE-GIRELQAR 332
            C +L  EM HF+  +QYYI FEVLE SW    N ++           HE +L++I  + LL   S+ L   L  +FD I+  ++  D +Y   + ELQ R
Sbjct:  702 CHILASEMVHFIHQMQYYITFEVLECSWDELWNRVQQAQDLDHIIAAHEAFLNTITSRCLLDSNSRVLLNQLRAVFDQIIELQNAQDVMYRAALEELQRR 801          
The following BLAST results are available for this feature:
BLAST of EY659063 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
GCP3_XENLA1.176e-1137.00Gamma-tubulin complex component 3 homolog OS=Xenop... [more]
GCP3_HUMAN2.005e-1136.00Gamma-tubulin complex component 3 OS=Homo sapiens ... [more]
GCP3_MOUSE4.467e-1136.00Gamma-tubulin complex component 3 OS=Mus musculus ... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-A03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659063 ID=EY659063|Name=EY659063|organism=Citrus sinensis|type=EST|length=912bp
CCACGCGTCCGCGGACGCGTGGGCGGACGCGTGGGTGCCAGGTTCTTTGG
GATGAGATGAATCATTTTGTCACAAATCTGCAATATTATATTATGTTTGA
GGTCTTGGAGGTGTCTTGGTCTAATTTCTCAAATGAAATGGAAGCAGCCA
AAGATCTAGACGATCTACTTGCAGCACATGAGAAGTACCTCCACTCTATA
TTTGAGAAGTCTCTCCTTGGTGAACGATCACAATCGCTTTTCAAGTCTCT
CTTTGTCTTGTTTGACCTCATATTGCGATTCAGAAGTCATGCAGATAGGT
TATATGAAGGAATTCGTGAGTTGCAAGCTAGAACCATGGAATCATCTTTA
TCCTCACGAGACAAGAAAAAATCATCGAGACAAACGAATGATATGCACAC
AAAACCTGGTTCATGGCTCAGTGATGGCAGGAAAGCTCTAACACAACGTG
CGGGTGAATTTCTTCGAAATATGGAACAAGAGCTGGATGCAACAGCAAAT
GAATACACGTCATTGCTTGAGGTTTTCTTAGCTCAGTTGCCTGTGCAGCA
ACATGTCGACTTAAAATTTCTCCTATTCCNGCTTGACTTTACTGAATTTT
ACACTCGGTTGCGTCCCAGTGTGTAGTAAAGCTGTCAATACATTTAGAGT
CAAGGATCTTTTTTAACACCTCAATGTATGACAAAGTGGTGACTTGCTAA
TTGATTGCCACTGTGCAAGTGAACCATCATGTGGGTGCTTTGCTGACATC
TAGACCAACCTGNNTCGTTTTCTATTGCTTGACATTAGATGGGGTTTCCT
GTTTCTGAAGACTGGGGGAAGAATTCCAGTGATTGGAGGGCCATTGGATT
CCTAAACAAAAGGTTAAATGANTTGGGCACCCTTGAATTTGAAAGCCATG
GCTGGGGGTTCC
back to top