EY675325

Overview
NameEY675325
Unique NameEY675325
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length970
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY675325 vs. ExPASy Swiss-Prot
Match: SERC3_HUMAN (Serine incorporator 3 OS=Homo sapiens GN=SERINC3 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 8.887e-13
Identity = 47/164 (28.66%), Postives = 78/164 (47.56%), Query Frame = 3
Query:   30 HSGWWSAKIVLWIALTIIPFLLPSS-FIQLYGEIAHFGAGVFLLIQLISVISFI-----TWLNDCCLSEKNAERCHIHVMLIATVAXXXXXXXXXXXXXWYTPDPTCLLNIFFITWTLVLLQLMTSVSLHPKI-----NSGFLAPGLMGLYIIFLCWCAIRNEP 488
            H+G+W  KI   I + +  F +P   F  ++  +   GA +F+LIQL+ ++ F      +W+N   + E N    +  ++   +               +YT    C  N FFI+  L+L  + + +S+HPKI      SG L   L+ LY ++L W A+ NEP
Sbjct:  130 HNGFWFFKIAALIGIMVGSFYIPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNR--MEEGNPRLWYAALLSFTSAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEP 291          
BLAST of EY675325 vs. ExPASy Swiss-Prot
Match: SERC3_BOVIN (Serine incorporator 3 OS=Bos taurus GN=SERINC3 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.161e-12
Identity = 47/164 (28.66%), Postives = 81/164 (49.39%), Query Frame = 3
Query:   30 HSGWWSAKIVLWIALTIIPFLLPSS-FIQLYGEIAHFGAGVFLLIQLISVISFI-----TWLNDCCLSEKNAERCHIHVMLIATVAXXXXXXXXXXXXXWYTPDPTCLLNIFFITWTLVLLQLMTSVSLHPKI-----NSGFLAPGLMGLYIIFLCWCAIRNEP 488
            H+G+W  KI   + + +  F +P   F   +  I   GA  F+LIQL+ ++ F      +W+N   + E N +  +  ++ + ++              +YT    C  N FFI++ L+L  +++ +S+HPKI      SG L   L+ LY ++L W A+ NEP
Sbjct:  129 HNGFWFFKIAAIVGVMVGSFYIPGGHFNTAWFVIGMVGAAFFILIQLVLLVDFAHSWNESWVNR--MEEGNPKCWYAALLSVTSLFYILSIIFAGLLYTYYTKPDGCTENKFFISFNLILCVVISVLSIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEP 290          
BLAST of EY675325 vs. ExPASy Swiss-Prot
Match: SERC3_PONAB (Serine incorporator 3 OS=Pongo abelii GN=SERINC3 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.980e-12
Identity = 46/164 (28.05%), Postives = 78/164 (47.56%), Query Frame = 3
Query:   30 HSGWWSAKIVLWIALTIIPFLLPSS-FIQLYGEIAHFGAGVFLLIQLISVISFI-----TWLNDCCLSEKNAERCHIHVMLIATVAXXXXXXXXXXXXXWYTPDPTCLLNIFFITWTLVLLQLMTSVSLHPKI-----NSGFLAPGLMGLYIIFLCWCAIRNEP 488
            H+G+W  KI   I + +  F +P   F  ++  +   GA +F+LIQL+ ++ F      +W+N   + E N    +  ++   +               +YT    C  N FFI+  L+L  + + +S+HPKI      SG L   ++ LY ++L W A+ NEP
Sbjct:  130 HNGFWFFKIAALIGIMVGSFYIPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNR--MEEGNPRLWYAALLSFTSAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSVITLYTMYLTWSAMSNEP 291          
The following BLAST results are available for this feature:
BLAST of EY675325 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
SERC3_HUMAN8.887e-1328.66Serine incorporator 3 OS=Homo sapiens GN=SERINC3 P... [more]
SERC3_BOVIN1.161e-1228.66Serine incorporator 3 OS=Bos taurus GN=SERINC3 PE=... [more]
SERC3_PONAB1.980e-1228.05Serine incorporator 3 OS=Pongo abelii GN=SERINC3 P... [more]
back to top
Libraries
Library NameType
Sweet orange leaf, infected with CiLVcdna_library
Properties
Property NameValue
Genbank descriptionCS00-C1-401-009-B03-CT.F Sweet orange leaf, infected with CiLV Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY675325 ID=EY675325|Name=EY675325|organism=Citrus sinensis|type=EST|length=970bp
CAAAGTTGCACGGGACCAGCCATTTATGGCACTCTGGATGGTGGTCTGCA
AAGATTGTCCTTTGGATTGCCTTGACAATCATCCCATTTCTTCTTCCTTC
TTCCTTTATTCAACTCTATGGGGAGATTGCTCATTTTGGTGCCGGGGTCT
TTCTACTAATTCAGCTAATAAGCGTAATCAGTTTCATTACCTGGCTGAAT
GACTGTTGTTTGTCTGAGAAGAATGCAGAAAGATGCCACATCCATGTGAT
GCTAATTGCAACAGTTGCATATATTATATGCATAGTGGGGATCATTATGA
TGTACATTTGGTATACGCCAGATCCTACTTGCCTCCTTAACATATTTTTT
ATTACATGGACTTTGGTGCTCCTCCAACTCATGACGAGTGTTTCTCTTCA
CCCAAAAATAAATTCAGGCTTCTTGGCTCCGGGGCTTATGGGGCTTTATA
TCATATTTCTCTGCTGGTGTGCCATTAGAAATGAACCAGCAGGGGAAACT
TTGCACAGGAAGGAAAAGCCTTCAAAAAAAACAGACTGGGCTACAATTTA
TAAGCTTTGTTGTTGCACTACTTTCAATTGGTATCGCCAACCTTTTTCAC
AGGCATTGATTCCCCAAGGCTTCCCGTTAAAGGAAAAAATGGATCCCCCG
GACAAAAAAAGAAGTCCCAAAAGGGTAATGGGGTTCCTTCCATTTTCGTT
TTTGACCCCCAGGGGGCAAAAGATATTTGGCAAGGCCCACCCCAAAAGGG
GGGAAAACCCCCTCACACTCAATTAAAAAGGGGGAAAAATAAAGGGGGGG
TGTGGAACAAGTAAATTGTGGGGGAGAAGATAACAAAAAAAATGGGGGGG
GGAGCGCATGGGAAAAACATGGGGGGAAACCGCGGTGGGGCCCCCCATCC
CAAATATATAAAAAAAAAGACCACAAAATCCCCACAGTAAACCGTATATT
ATTAAATTAAAAAAGAGGCT
back to top