EY675320

Overview
NameEY675320
Unique NameEY675320
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length932
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY675320 vs. ExPASy Swiss-Prot
Match: XTH6_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 6 OS=Arabidopsis thaliana GN=XTH6 PE=2 SV=2)

HSP 1 Score: 218.779 bits (556), Expect = 3.587e-56
Identity = 95/123 (77.24%), Postives = 106/123 (86.18%), Query Frame = 3
Query:   12 DVPIRVYQNSG--RAPFPMNQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPANCASNPGNWWEANNYQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPPECLA 374
            DVPIR Y+N+      +P +QPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYY+DFDIEGCPVPGP  C SNP NWWE   YQ+L A+EARRYRWVR+NHM+YDYCTD+SR+PVPPPEC A
Sbjct:  170 DVPIREYKNNEAKNIAYPTSQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYKDFDIEGCPVPGPTFCPSNPHNWWEGYAYQSLNAVEARRYRWVRVNHMVYDYCTDRSRFPVPPPECRA 292          
BLAST of EY675320 vs. ExPASy Swiss-Prot
Match: XTH7_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 7 OS=Arabidopsis thaliana GN=XTH7 PE=2 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 1.780e-55
Identity = 92/125 (73.60%), Postives = 109/125 (87.20%), Query Frame = 3
Query:   12 DVPIRVYQNSG--RAPFPMNQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPANCASNPGNWWEANNYQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPPECLAGI 380
            +VPIRVY+N+   + P+P  QPMGVYSTLWEADDWATRGG+EKI+WS+APFYAYY+DFDIEGCPVPGPA+C +N  NWWE + Y  L+ +EAR YRWVR+NHM+YDYCTDKSR+PVPPPEC AGI
Sbjct:  169 NVPIRVYKNNEARKVPYPRFQPMGVYSTLWEADDWATRGGIEKINWSRAPFYAYYKDFDIEGCPVPGPADCPANSKNWWEGSAYHQLSPVEARSYRWVRVNHMVYDYCTDKSRFPVPPPECSAGI 293          
BLAST of EY675320 vs. ExPASy Swiss-Prot
Match: XTH1_SOLLC (Probable xyloglucan endotransglucosylase/hydrolase 1 OS=Solanum lycopersicum GN=XTH1 PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 2.046e-35
Identity = 66/124 (53.23%), Postives = 84/124 (67.74%), Query Frame = 3
Query:   12 DVPIRVYQNSGR--APFPMNQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPAN---CASNPGNWWEANNYQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPPEC 368
            DVPIR ++NS      FP NQPM +YS+LW+ADDWATRGGLEK +W+ APF A Y  F ++GC    P     C +    WW+   +Q L A++ RR RWVR  + +Y+YCTDK+RYPVPPPEC
Sbjct:  167 DVPIRAFKNSKDLGVKFPFNQPMKIYSSLWDADDWATRGGLEKTNWANAPFTASYTSFHVDGCEAATPQEVQVCNTKGMKWWDQKAFQDLDALQYRRLRWVRQKYTVYNYCTDKARYPVPPPEC 290          
BLAST of EY675320 vs. ExPASy Swiss-Prot
Match: XTH5_ARATH (Probable xyloglucan endotransglucosylase/hydrolase protein 5 OS=Arabidopsis thaliana GN=XTH5 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.016e-34
Identity = 66/122 (54.10%), Postives = 83/122 (68.03%), Query Frame = 3
Query:   12 DVPIRVYQNSGRA--PFPMNQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPAN-CASNPGNWWEANNYQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPPEC 368
            DVPIRV++NS      FP NQPM +YS+LW ADDWATRGGLEK +W KAPF A YR F ++GC     A  C +    WW+   +Q L A + +R +WVR  + IY+YCTD+ R+PVPPPEC
Sbjct:  166 DVPIRVFKNSKDVGVKFPFNQPMKIYSSLWNADDWATRGGLEKTNWEKAPFVASYRGFHVDGCEASVNAKFCETQGKRWWDQKEFQDLDANQYKRLKWVRKRYTIYNYCTDRVRFPVPPPEC 287          
BLAST of EY675320 vs. ExPASy Swiss-Prot
Match: XTH_TOBAC (Probable xyloglucan endotransglucosylase/hydrolase protein OS=Nicotiana tabacum GN=XTH PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.263e-34
Identity = 66/124 (53.23%), Postives = 81/124 (65.32%), Query Frame = 3
Query:   12 DVPIRVYQNSGR--APFPMNQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPAN---CASNPGNWWEANNYQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPPEC 368
            DVPIR ++NS      FP NQPM +YS+LW+ADDWATRGGLEK DWS APF A Y  F ++GC    P     C +    WW+   +Q L A++ RR RWVR  + IY+YCTD+ RYP  PPEC
Sbjct:  166 DVPIRAFKNSKDLGVKFPFNQPMKIYSSLWDADDWATRGGLEKTDWSNAPFTASYTSFHVDGCEAATPQEVQVCNTKGMRWWDQKAFQDLDALQYRRLRWVRQKYTIYNYCTDRKRYPTLPPEC 289          
BLAST of EY675320 vs. ExPASy Swiss-Prot
Match: XTHB_PHAAN (Probable xyloglucan endotransglucosylase/hydrolase protein B OS=Phaseolus angularis GN=XTHB PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.621e-32
Identity = 62/122 (50.82%), Postives = 82/122 (67.21%), Query Frame = 3
Query:   12 DVPIRVYQNSGR--APFPMNQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPAN-CASNPGNWWEANNYQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPPEC 368
            ++PIRV++N       FP NQPM VY++LW ADDWATRGGLEK DWSKAPF A Y+ F ++GC     +  CA+    WW+   ++ L + + RR +WVR    IY+YCTD++RYP  PPEC
Sbjct:  166 NIPIRVFKNLKELGVKFPFNQPMKVYNSLWNADDWATRGGLEKTDWSKAPFVAEYKGFHVDGCEASVNSRFCATQGKRWWDQTEFRDLDSFQWRRLKWVRQKFTIYNYCTDRTRYPQLPPEC 287          
BLAST of EY675320 vs. ExPASy Swiss-Prot
Match: XTH_BRAOB (Xyloglucan endotransglucosylase/hydrolase OS=Brassica oleracea var. botrytis GN=XET16A PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.118e-32
Identity = 63/122 (51.64%), Postives = 84/122 (68.85%), Query Frame = 3
Query:   12 DVPIRVYQNSGR--APFPMNQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPAN-CASNPGNWWEANNYQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPPEC 368
            ++PIRV++N+      FP NQPM +YS+LW ADDWATRGGLEK +W+ APF A YR F I+GC     A  CA+    WW+ N ++ L A + RR +WVR+   IY+YCTD++R+PV P EC
Sbjct:  168 NIPIRVFKNAKDLGVRFPFNQPMKLYSSLWNADDWATRGGLEKTNWANAPFIASYRGFHIDGCQASVEAKYCATQGRMWWDQNEFRDLDAEQYRRLKWVRMKWTIYNYCTDRTRFPVMPAEC 289          
BLAST of EY675320 vs. ExPASy Swiss-Prot
Match: XTH_WHEAT (Probable xyloglucan endotransglucosylase/hydrolase OS=Triticum aestivum GN=XTH PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 3.612e-32
Identity = 64/122 (52.46%), Postives = 77/122 (63.11%), Query Frame = 3
Query:   12 DVPIRVYQNSGR--APFPMNQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPAN-CASNPGNWWEANNYQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPPEC 368
            D PIRV++NS      +P +QPM +YS+LW ADDWATRGG EK DWSKAPF A YR F ++GC     A  CA+    WW+   +Q L A + RR  WVR  H IY+YCTD  RY    PEC
Sbjct:  166 DTPIRVFKNSKDLGVRYPFDQPMKLYSSLWNADDWATRGGREKTDWSKAPFVASYRGFHVDGCEASAEAKFCATQGARWWDQPEFQDLDAAQYRRLAWVRKEHTIYNYCTDHDRYAAMAPEC 287          
BLAST of EY675320 vs. ExPASy Swiss-Prot
Match: XTH_SOYBN (Probable xyloglucan endotransglucosylase/hydrolase (Fragment) OS=Glycine max GN=XTH PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 6.162e-32
Identity = 65/123 (52.85%), Postives = 82/123 (66.67%), Query Frame = 3
Query:   12 DVPIRVYQNSGR--APFPMNQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPAN-CASNPGNWWEANNYQALTAMEARRYRWVRLNHMIYDYCTDKSRYP-VPPPEC 368
            +VPIRV++NS      FP +QPM +Y++LW ADDWATRGGLEK DWSKAPF A Y+ F I+GC     A  C +    WW+   ++ L A + RR RWVR  + IY+YCTD  RYP + PPEC
Sbjct:  167 EVPIRVFKNSKDLGVKFPFDQPMKIYNSLWNADDWATRGGLEKTDWSKAPFIAAYKGFHIDGCEASVNAKFCDTQGKRWWDQPEFRDLDAAQWRRLRWVRQKYTIYNYCTDTKRYPHISPPEC 289          
BLAST of EY675320 vs. ExPASy Swiss-Prot
Match: XTHA_PHAAN (Xyloglucan endotransglucosylase/hydrolase protein A OS=Phaseolus angularis GN=XTHA PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.994e-31
Identity = 62/122 (50.82%), Postives = 79/122 (64.75%), Query Frame = 3
Query:   12 DVPIRVYQNSGR--APFPMNQPMGVYSTLWEADDWATRGGLEKIDWSKAPFYAYYRDFDIEGCPVPGPAN-CASNPGNWWEANNYQALTAMEARRYRWVRLNHMIYDYCTDKSRYPVPPPEC 368
            D PIRV++NS      FP NQPM +Y++LW ADDWATRGGLEK DWSKAPF A Y+ F I+GC     A  C +    WW+   ++ L A + ++  WVR  + IY+YCTD+ RY   PPEC
Sbjct:  165 DYPIRVFKNSNDLGVKFPFNQPMKIYNSLWNADDWATRGGLEKTDWSKAPFIASYKGFHIDGCEASVNAKFCDTQGKRWWDQPEFRDLDAAQWQKLAWVRNKYTIYNYCTDRKRYSQVPPEC 286          
The following BLAST results are available for this feature:
BLAST of EY675320 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 39
Match NameE-valueIdentityDescription
XTH6_ARATH3.587e-5677.24Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH7_ARATH1.780e-5573.60Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH1_SOLLC2.046e-3553.23Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH5_ARATH1.016e-3454.10Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH_TOBAC2.263e-3453.23Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTHB_PHAAN1.621e-3250.82Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH_BRAOB2.118e-3251.64Xyloglucan endotransglucosylase/hydrolase OS=Brass... [more]
XTH_WHEAT3.612e-3252.46Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTH_SOYBN6.162e-3252.85Probable xyloglucan endotransglucosylase/hydrolase... [more]
XTHA_PHAAN3.994e-3150.82Xyloglucan endotransglucosylase/hydrolase protein ... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange leaf, infected with CiLVcdna_library
Properties
Property NameValue
Genbank descriptionCS00-C1-401-009-A09-CT.F Sweet orange leaf, infected with CiLV Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY675320 ID=EY675320|Name=EY675320|organism=Citrus sinensis|type=EST|length=932bp
CCACGCGTCCGGATGTGCCCATCAGGGTTTACCAAAACAGTGGAAGGGCT
CCATTTCCAATGAACCAACCCATGGGGGTGTATTCGACGCTGTGGGAAGC
AGATGACTGGGCAACAAGAGGTGGTCTAGAGAAAATAGATTGGAGCAAAG
CTCCTTTTTATGCTTATTACAGAGACTTTGATATTGAGGGCTGCCCAGTT
CCTGGACCAGCAAACTGTGCCTCGAACCCAGGTAACTGGTGGGAGGCAAA
TAATTATCAAGCCCTCACCGCCATGGAAGCAAGAAGATACAGATGGGTTC
GTCTCAACCACATGATCTATGATTATTGCACTGATAAATCAAGATACCCA
GTACCCCCACCGGAATGCCTTGCCGGCATATAAATTCAACCCGCCAATTA
ATTAAGCAGTTGGACGGTACTCCATATCCGTATCATATCATGTATATTAC
TTCACGTACACGTCCCTTTGTATTATTCCCTATTCTTGTGAAAAAGACTT
ATACGCATATCAAGGGAGGGGGCGGAGGGAAAAAATAAAACATTGGTGGG
CTTTTAATTGTGATTATGGGAGTGGGAAATATGTGGGTATTCCTGGCTCC
CTTGGTACCCATATATAAGTCCGAAATTTGAAGCCCAGTATTCTGTGCCA
ATAAGAGCCCTCCTTTCTTATTGTGGGAAAAAAATAAATATAAAAAAGAA
TAAAAAGAGAAGAAGAAGTTCATATTGCACAATTGAAAATGAGATAAAAG
TTATGATATGAAACGTATTTGGATTGATGAGTATAAGGGGGGGGCGCCCT
CTGAAGGGAATCAGTTCTTAGTGCCCGGGCGGCGGGGAAGTCATACCTCT
CTTATAATGGTGCCAAAAAATTTATTTCTCGGGGCGCGGTTTTTAACCCA
GTATGGGGGGGAGAAAAACCCTGCGTGCTCAC
back to top