EY674756

Overview
NameEY674756
Unique NameEY674756
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1005
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY674756 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 2.002e-55
Identity = 105/143 (73.43%), Postives = 118/143 (82.52%), Query Frame = 3
Query:   96 FVGKAVNLAPSGNELSNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFGPQTESSSVKAVWIKGGAPNLSTRAGLDYLGNPKL 518
            F GKAV L+PS +E++  G+++MRKTASK+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL   +      +AVW K G+  + +  GLDYLGNP L
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA-RNGVKFGEAVWFKAGS-QIFSEGGLDYLGNPSL 153          
BLAST of EY674756 vs. ExPASy Swiss-Prot
Match: CB21_TOBAC (Chlorophyll a-b binding protein 16, chloroplastic OS=Nicotiana tabacum GN=CAB16 PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 2.614e-55
Identity = 105/143 (73.43%), Postives = 118/143 (82.52%), Query Frame = 3
Query:   96 FVGKAVNLAPSGNELSNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFGPQTESSSVKAVWIKGGAPNLSTRAGLDYLGNPKL 518
            F GKAV L+PS +E++  G+++MRKTASK+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL   +      +AVW K G+  + +  GLDYLGNP L
Sbjct:   12 FAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA-RNGVKFGEAVWFKAGS-QIFSEGGLDYLGNPSL 152          
BLAST of EY674756 vs. ExPASy Swiss-Prot
Match: CB22_PETSP (Chlorophyll a-b binding protein 22L, chloroplastic OS=Petunia sp. GN=CAB22L PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 4.459e-55
Identity = 104/143 (72.73%), Postives = 118/143 (82.52%), Query Frame = 3
Query:   96 FVGKAVNLAPSGNELSNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFGPQTESSSVKAVWIKGGAPNLSTRAGLDYLGNPKL 518
            F GK V L+PS +E++  G+ +MRKTA+K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELF  +      +AVW+K G+  + +  GLDYLGNP L
Sbjct:   13 FAGKVVKLSPSSSEITGNGKATMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFA-RNGVKFGEAVWLKAGS-QIFSEGGLDYLGNPSL 153          
BLAST of EY674756 vs. ExPASy Swiss-Prot
Match: CB2G_SOLLC (Chlorophyll a-b binding protein 3C, chloroplastic OS=Solanum lycopersicum GN=CAB3C PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 5.824e-55
Identity = 104/143 (72.73%), Postives = 117/143 (81.82%), Query Frame = 3
Query:   96 FVGKAVNLAPSGNELSNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFGPQTESSSVKAVWIKGGAPNLSTRAGLDYLGNPKL 518
            F GKAV L+PS +E++  GR++MRKTA+K+   SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL   +      +AVW K G+  + +  GLDYLGNP L
Sbjct:   13 FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA-RNGVKFGEAVWFKAGS-QIFSEGGLDYLGNPSL 153          
BLAST of EY674756 vs. ExPASy Swiss-Prot
Match: CB25_NICPL (Chlorophyll a-b binding protein E, chloroplastic OS=Nicotiana plumbaginifolia GN=CABE PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 5.824e-55
Identity = 104/143 (72.73%), Postives = 118/143 (82.52%), Query Frame = 3
Query:   96 FVGKAVNLAPSGNELSNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFGPQTESSSVKAVWIKGGAPNLSTRAGLDYLGNPKL 518
            F GKAV L+PS +E++  G+++MRKTA+K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL   +      +AVW K G+  + +  GLDYLGNP L
Sbjct:   12 FAGKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA-RNGVKFGEAVWFKAGS-QIFSEGGLDYLGNPSL 152          
BLAST of EY674756 vs. ExPASy Swiss-Prot
Match: CB23_NICPL (Chlorophyll a-b binding protein C, chloroplastic OS=Nicotiana plumbaginifolia GN=CABC PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 5.824e-55
Identity = 104/143 (72.73%), Postives = 119/143 (83.22%), Query Frame = 3
Query:   96 FVGKAVNLAPSGNELSNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFGPQTESSSVKAVWIKGGAPNLSTRAGLDYLGNPKL 518
            F GKAV L+PS +E++  G+++MRKTASK+  VSS SPWYGP+RVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL   +      +AVW KGG+  + ++ GLDYLGNP L
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA-RNGVKFGEAVWFKGGS-QIFSQGGLDYLGNPSL 153          
BLAST of EY674756 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 9.934e-55
Identity = 102/141 (72.34%), Postives = 114/141 (80.85%), Query Frame = 3
Query:   96 FVGKAVNLAPSGNELSNGGRISMRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFGPQTESSSVKAVWIKGGAPNLSTRAGLDYLGNPKL 518
            F G+AV L+PS  E++  GR+SMRKT +K V+S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL   +      +AVW K G+  + +  GLDYLGNP L
Sbjct:   13 FAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA-RNGVKFGEAVWFKAGS-QIFSEGGLDYLGNPSL 151          
BLAST of EY674756 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.695e-54
Identity = 102/141 (72.34%), Postives = 113/141 (80.14%), Query Frame = 3
Query:   96 FVGKAVNLAPSGNELSNGGRISMRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFGPQTESSSVKAVWIKGGAPNLSTRAGLDYLGNPKL 518
            F G+AV L+PS +E+S  GRI+MRK  +KS  S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL   +      +AVW K G+  + +  GLDYLGNP L
Sbjct:   13 FAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA-RNGVKFGEAVWFKAGS-QIFSEGGLDYLGNPSL 151          
BLAST of EY674756 vs. ExPASy Swiss-Prot
Match: CB25_TOBAC (Chlorophyll a-b binding protein 50, chloroplastic OS=Nicotiana tabacum GN=CAB50 PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.890e-54
Identity = 102/143 (71.33%), Postives = 117/143 (81.82%), Query Frame = 3
Query:   96 FVGKAVNLAPSGNELSNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFGPQTESSSVKAVWIKGGAPNLSTRAGLDYLGNPKL 518
            F GKAV L+PS +E++  G+++MRKT +K+  +SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL   +      +AVW K G+  + +  GLDYLGNP L
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA-RNGVKFGEAVWFKAGS-QIFSEGGLDYLGNPSL 153          
BLAST of EY674756 vs. ExPASy Swiss-Prot
Match: CB21_CUCSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 4.930e-54
Identity = 102/139 (73.38%), Postives = 113/139 (81.29%), Query Frame = 3
Query:  102 GKAVNLAPSGNELSNGGRISMRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFGPQTESSSVKAVWIKGGAPNLSTRAGLDYLGNPKL 518
            G+AV L+P+  E+    + +MRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEL   +      +AVW K G+  + +  GLDYLGNP L
Sbjct:    5 GQAVKLSPNAPEIQGNAKFTMRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLS-RNGVKFGEAVWFKAGS-QIFSEGGLDYLGNPSL 141          
The following BLAST results are available for this feature:
BLAST of EY674756 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
CB24_TOBAC2.002e-5573.43Chlorophyll a-b binding protein 40, chloroplastic ... [more]
CB21_TOBAC2.614e-5573.43Chlorophyll a-b binding protein 16, chloroplastic ... [more]
CB22_PETSP4.459e-5572.73Chlorophyll a-b binding protein 22L, chloroplastic... [more]
CB2G_SOLLC5.824e-5572.73Chlorophyll a-b binding protein 3C, chloroplastic ... [more]
CB25_NICPL5.824e-5572.73Chlorophyll a-b binding protein E, chloroplastic O... [more]
CB23_NICPL5.824e-5572.73Chlorophyll a-b binding protein C, chloroplastic O... [more]
CB22_TOBAC9.934e-5572.34Chlorophyll a-b binding protein 21, chloroplastic ... [more]
CB2B_SOLLC1.695e-5472.34Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB25_TOBAC2.890e-5471.33Chlorophyll a-b binding protein 50, chloroplastic ... [more]
CB21_CUCSA4.930e-5473.38Chlorophyll a-b binding protein of LHCII type I, c... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange leaf, infected with CiLVcdna_library
Properties
Property NameValue
Genbank descriptionCS00-C1-401-001-A12-CT.F Sweet orange leaf, infected with CiLV Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY674756 ID=EY674756|Name=EY674756|organism=Citrus sinensis|type=EST|length=1005bp
CTTCTCTTGCTTACACAGCTTCTCTTGCTTACCCAGCTTCTGCTTCTCAA
TTAAATTCCTCAATGGCAACCTCAACAATGGCTCTCTCCTCATCATTCGT
CGGCAAGGCCGTGAACCTCGCCCCTTCAGGCAATGAGCTAAGCAATGGTG
GCCGCATCTCCATGCGTAAAACCGCGAGCAAGTCTGTTTCTTCAGGTAGC
CCGTGGTACGGCCCAGACAGAGTCAAGTACTTGGGCCCATTCTCTGGCGA
GCCCCCAAGCTACTTGACCGGTGAGTTCCCTGGCGACTACGGTTGGGACA
CAGCCGGGCTTTCAGCTGACCCAGAAACCTTTGCCAAGAACCGTGAACTC
GAAGTCATCCACTGCAGATGGGCCATGTTGGGAGCTCTTGGATGCGTCTT
CCCGGAGCTCTTTGGCCCGCAAACGGAATCAAGTTCAGTGAAAGCCGTGT
GGATCAAGGGGGGAGCCCCAAATCTTTCAACGAGGGCGGGGCTAGACTAC
TTGGGAAACCCCAAGCTTGAATCCCAAGCCCGAAAACATCTTGGCCAATC
TGGGCTTGGCCAAAGGTGGGATCTTTGAAAGGGAACCCGTAAAGGGTTAC
AAAAATAGCTGGGAGGGCCGCTAGGTTGAAAATAAAATGAACCCCATTTG
AAACCAAGGTGGGACACTTTTTAAACCCTTAGGGAGTTTTGGGCATGAGG
AACCCGGAAGGGATTTTGGTAAAAACTCAAAAGGTAAAAGAAAAAAAAAA
AATAGAAAGAGGAGGGGTAAATTATCCCACAGATTTTGGGTTTAATACTC
AATAAGAGGAATTTTGAACACAAGCAAAGGGAAGCCCTATTAAAAAAAAA
AGTGGGAAAACAAAACAATTGGAGAAAAAAAACCAGAAAATAAAAAAAAA
AAGAAAAATCGGGAGGAACACAATCCACCCCACACAAAAAAATTTTTTAA
CCCCCACAGGAAAAAAAAAGAGAAGAGAGAGACGTCCAAGGGGAGGGCGT
AAGAA
back to top