EY674755

Overview
NameEY674755
Unique NameEY674755
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1040
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY674755 vs. ExPASy Swiss-Prot
Match: PPF1_PEA (Inner membrane protein PPF-1, chloroplastic OS=Pisum sativum GN=PPF-1 PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 2.585e-24
Identity = 40/71 (56.34%), Postives = 52/71 (73.24%), Query Frame = 2
Query:  419 SDAMEFVLKILKDGMDAVHVPYSYGFAIILLTVLVKVATFPFNEKPGGIKGTNA-KPFNLK*KACRQKNAG 628
            SD MEFVLK+LKDG+ +VHVPYSYGFAIILLTV+VK AT P  ++   ++ T A +    K KA +++ AG
Sbjct:   95 SDGMEFVLKVLKDGLSSVHVPYSYGFAIILLTVIVKAATLPLTKQQ--VESTLAMQNLQPKIKAIQERYAG 163          

HSP 2 Score: 60.4622 bits (145), Expect = 2.585e-24
Identity = 38/107 (35.51%), Postives = 50/107 (46.73%), Query Frame = 1
Query:   97 MTKTLISSRPFVGTXXXXXXXXXXXXXXXXXXNRRLASTRVRLSFQKIPPVLSLDSSIDLNSVFSRSESLLYXXXXXXXXXXXXXXXXXXXXXXXXXQKNGGWFGFI 417
            M KTLISS  F+GT                  NR    T+V+ SF ++PP+ S+  S+DL+ +F+R+E LLY                         QKNGGWFGFI
Sbjct:    1 MAKTLISSPSFLGTPLPSLHRTFSP-------NRTRLFTKVQFSFHQLPPIQSVSHSVDLSGIFARAEGLLY------TLADATVAADAAASTDVAAQKNGGWFGFI 94          
BLAST of EY674755 vs. ExPASy Swiss-Prot
Match: ALB3_ARATH (Inner membrane protein ALBINO3, chloroplastic OS=Arabidopsis thaliana GN=ALB3 PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 1.341e-22
Identity = 41/71 (57.75%), Postives = 53/71 (74.65%), Query Frame = 2
Query:  419 SDAMEFVLKILKDGMDAVHVPYSYGFAIILLTVLVKVATFPFNEKPGGIKGTNA-KPFNLK*KACRQKNAG 628
            SDAME VLKILKDG+ AVHVPY+YGFAIILLT++VK AT+P  ++   ++ T A +    K KA +Q+ AG
Sbjct:  117 SDAMELVLKILKDGLSAVHVPYAYGFAIILLTIIVKAATYPLTKQQ--VESTLAMQNLQPKIKAIQQRYAG 185          

HSP 2 Score: 53.1434 bits (126), Expect = 1.341e-22
Identity = 29/70 (41.43%), Postives = 37/70 (52.86%), Query Frame = 1
Query:  208 STRVRLSFQKIPPVLSLDSSIDLNSVFSRSESLLYXXXXXXXXXXXXXXXXXXXXXXXXXQKNGGWFGFI 417
            ST VR S  +IPP   LDSS+D+ ++F+R+ESLLY                         QK+GGWFGFI
Sbjct:   51 STTVRFSLNEIPPFHGLDSSVDIGAIFTRAESLLY----TIADAAVVGADSVVTTDSSAVQKSGGWFGFI 116          
BLAST of EY674755 vs. ExPASy Swiss-Prot
Match: ALB31_ARATH (ALBINO3-like protein 1, chloroplastic OS=Arabidopsis thaliana GN=ALB3L1 PE=2 SV=3)

HSP 1 Score: 71.2478 bits (173), Expect = 1.088e-11
Identity = 39/72 (54.17%), Postives = 50/72 (69.44%), Query Frame = 2
Query:  428 MEFVLKILKDGMDAVHVPYSYGFAIILLTVLVKVATFPFNEKPGGIKGTNA-KPFNLK*KACRQKNAGESGK 640
            ME +LK+LKDG+  VHVPYSYGFAIILLTVLVK ATFP  +K   ++   A K    + KA +++ AG+  K
Sbjct:  104 METILKVLKDGLSTVHVPYSYGFAIILLTVLVKAATFPLTKKQ--VESAMAMKSLTPQIKAIQERYAGDQEK 173          
The following BLAST results are available for this feature:
BLAST of EY674755 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
PPF1_PEA2.585e-2456.34Inner membrane protein PPF-1, chloroplastic OS=Pis... [more]
ALB3_ARATH1.341e-2257.75Inner membrane protein ALBINO3, chloroplastic OS=A... [more]
ALB31_ARATH1.088e-1154.17ALBINO3-like protein 1, chloroplastic OS=Arabidops... [more]
back to top
Libraries
Library NameType
Sweet orange leaf, infected with CiLVcdna_library
Properties
Property NameValue
Genbank descriptionCS00-C1-401-001-A11-CT.F Sweet orange leaf, infected with CiLV Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY674755 ID=EY674755|Name=EY674755|organism=Citrus sinensis|type=EST|length=1040bp
CCACGCGTCCGGTGCTTCCTCATCTCCACCCTTCATGAGAAGCTGAGCTC
AATTCTCATAAAAAAAAAAACAAAAGAGAAGAAAAATTCACCCTCCATGA
CCAAAACTCTGATTTCGTCTCGACCGTTCGTCGGCACACCACTCCCTTCA
CCATTATCGTCACTCTCTCGCCACGGGCTCCACCCGCTTCCTAACCGTAG
ACTCGCCTCGACCAGAGTGAGACTCAGCTTCCAAAAAATTCCTCCTGTTC
TCTCCCTCGACTCTTCTATCGATCTCAACTCAGTTTTTAGTCGAAGTGAG
AGCTTGCTTTACACGCTGGCAGACGCTGCCGTTTCACTTGATTCTGCTTC
TGGCGGAGCTGCCTCCACGTCAGCTGATGGGGCTACGCAGAAGAACGGCG
GCTGGTTCGGTTTTATCCTCTGACGCGATGGAATTCGTTCTCAAGATATT
GAAGGATGGGATGGATGCTGTTCATGTGCCGTATTCATATGGCTTTGCGA
TAATTTTGTTGACAGTTTTGGTTAAGGTTGCCACATTTCCTTTCAACGAG
AAACCGGGGGGAATCAAAGGTACCAATGCGAAACCTTTCAACCTTAAATA
AAAGGCTTGTCGGCAAAAAAATGCTGGGGAATCAGGAAAAAAATTCCCCT
TGGGAAATTCAGGTTTTAATCGGGGAGGGCTGGGGGTATACCCATGAACT
AGGGTGGTTTGCCAAGATTGGGGAAATATAAACAAGCGGGGGAAGGGGTT
TTTTCACACCTCTTTTCAAAATGGGGCAAAAAGAGGGTTTGTTTAAAAAA
AAGGGTTCCTTTTTGAAAAAACCCCCTCTTTGACCGGGGCGCACATAAAC
TTGCGCGCCCCCAAACAAAAGGGGGATTGGGGGTTCTTCCCGGGGTTCCT
ACCCACCGAGTGGGGGGGAGGGGCACCCCCCCAAAAAAGGGGGGGGGGGG
CGGGGGAAAAAACGGGGGACGAAAACACAAGGGTGTTGTTTATCCCGCGC
GCTCTTCCTTCTTGTGAGTTCCCCACTTTCTTCACAAAAA
back to top