EY702706

Overview
NameEY702706
Unique NameEY702706
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length712
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8092 contig Csv1_Contig8092:212..922. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY702706 vs. ExPASy Swiss-Prot
Match: Y1143_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g14390 OS=Arabidopsis thaliana GN=At1g14390 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.886e-11
Identity = 31/75 (41.33%), Postives = 46/75 (61.33%), Query Frame = 3
Query:   21 QLQSVITADESARRSMVDPAVNKACLDESLKTMMEVCVRCLLKNPAERPSVEDVLWNLQFAAQVQDAWHSQSSEG 245
            QL++ +  + S  RS+ DP V      ESL+T +E  + CL ++  +RPS+EDV+WNLQ+  QVQ  W S  + G
Sbjct:  648 QLENSLRDEPSVLRSLADPCVRGTYAYESLRTTVEFAINCLCEDQRKRPSIEDVVWNLQYTIQVQQGWTSSENLG 722          
The following BLAST results are available for this feature:
BLAST of EY702706 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y1143_ARATH3.886e-1141.33Probable LRR receptor-like serine/threonine-protei... [more]
back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (2 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-701-011-C11-CT.F Sweet orange fruit, development stadium (2 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY702706 ID=EY702706|Name=EY702706|organism=Citrus sinensis|type=EST|length=712bp
TTCGTCGACCCACGCGTCCGCAGTTACAATCTGTCATTACTGCTGATGAA
TCAGCACGACGGAGCATGGTTGATCCAGCAGTTAACAAGGCATGTTTGGA
TGAGTCACTGAAGACAATGATGGAAGTCTGTGTCAGGTGTCTGCTTAAGA
ACCCAGCAGAGAGACCTTCAGTTGAGGACGTGCTATGGAATTTGCAGTTT
GCTGCTCAAGTTCAGGATGCATGGCATTCTCAGAGCAGTGAAGGGTCTCC
AATCTCACCTCCATGGCCATCACACCAACACCTTTCCTTTCATTAGTTGC
AACATTCAGGACATGCTGTACGTGGCTTGATGACAATTGTGCCTGAACAT
TTTCTATCACTCCTACCTCTTTCCTTCCATGTAATTTTTGCGACAAACAA
CTCTAAAGTTACAGTTGAAGATGACATTTTTCAGAGAGACCAAAAGCTAG
CTGTCTCTTGTTATGCTAAACATCTTGTTTCCAGNTCTCCATGGTTGGAT
CCTAGCACATATCCTGGATTATAGATCAATGGTTGCAGGTCCCGTATCCC
AGTCAAATCATCTATGCATTTGTTTAATATTTTTCCACAATGATGATCAA
AGGGGGATATGTTGTCTGCGTCCATTACTCTTTCTTTACTATTGTAAGGT
GCACCTAAAAGTAATGATGTACAAGCTTTTTCTATGTTATGGATACCCCA
AAAAAAAAATAA
back to top