EY702692

Overview
NameEY702692
Unique NameEY702692
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length942
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9994 contig Csv1_Contig9994:1..944. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY702692 vs. ExPASy Swiss-Prot
Match: RPM1_ARATH (Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 3.343e-25
Identity = 73/218 (33.49%), Postives = 129/218 (59.17%), Query Frame = 1
Query:   79 RLIRLWIAEGFVQYSKRTTSEQVAEEYLNELVDRSLVQVSERDISGRASICQVHDLMHEIVIRKTEELGFGRVLN----GVDLSHCSK---TRRITIQRSIDDGALESIKHSKVRTVFLFNIDKLPNSFMKTSIANFKLMKVLDLEDSPIDYLPEGVGNLFNLHYLSVKNTEVKIIPKSIGNLLSLEILDLKNTLVSELPVEIGNLKKLRYLMGYQYN 711
            RLIR+W+A+ FV+  +   +E+VA+ YLNELV R+++QV   +  GR    ++HD++ EI +  ++   F  V N    G D +   +   +R + IQ+ +     +SI+ + + ++ + +  K     + +      L++ LDLEDS I  LP+ +  +FNL YL++  T+VK +PK+   L++LE L+ K++ + ELP+ +  LKKLRYL+ ++ N
Sbjct:  451 RLIRMWMAQRFVEPIRGVKAEEVADSYLNELVYRNMLQVILWNPFGRPKAFKMHDVIWEIALSVSKLERFCDVYNDDSDGDDAAETMENYGSRHLCIQKEMTP---DSIRATNLHSLLVCSSAKHKMELLPS----LNLLRALDLEDSSISKLPDCLVTMFNLKYLNLSKTQVKELPKNFHKLVNLETLNTKHSKIEELPLGMWKLKKLRYLITFRRN 661          
BLAST of EY702692 vs. ExPASy Swiss-Prot
Match: R13L3_ARATH (Putative disease resistance RPP13-like protein 3 OS=Arabidopsis thaliana GN=RPP13L3 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.830e-24
Identity = 73/221 (33.03%), Postives = 120/221 (54.30%), Query Frame = 1
Query:   58 ELHINCARLIRLWIAEGFVQYSKRTTSEQVAEEYLNELVDRSLVQVSERDISGRASICQVHDLMHEIVIRKTEELGFGRVLNGVDLSHCSKT-RRITIQRSIDDGALESIKHSKVRTVFLFNIDKLPNSFMKTSIANFKLMKVLDLED------SPIDYLPEGVGNLFNLHYLSVKNTEVKIIPKSIGNLLSLEILDLKNTLVSELPVEIGNLKKLRYLMG 699
            +  I   +LI L +AEGF+Q  +    E VA  Y++ELVDRSLV+ +ER   G+   C++HDL+ ++ I+K +EL F  V N  +  H S   RR  +   ++D  L   + +K    FLF  ++    ++ T+    KL++VL++E       +  + LP+ +G L +L YL + +T V I+P SI NL  L+ LD       +   ++  L  LR+++G
Sbjct:  430 DYEIKVEKLIHLLVAEGFIQEDEEMMMEDVARCYIDELVDRSLVK-AERIERGKVMSCRIHDLLRDLAIKKAKELNFVNVYN--EKQHSSDICRREVVHHLMNDYYLCDRRVNKRMRSFLFIGERRGFGYVNTTNLKLKLLRVLNMEGLLFVSKNISNTLPDVIGELIHLRYLGIADTYVSILPASISNLRFLQTLDASGNDPFQYTTDLSKLTSLRHVIG 647          
BLAST of EY702692 vs. ExPASy Swiss-Prot
Match: R13L2_ARATH (Putative disease resistance RPP13-like protein 2 OS=Arabidopsis thaliana GN=RPP13L2 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.113e-20
Identity = 72/224 (32.14%), Postives = 119/224 (53.12%), Query Frame = 1
Query:   58 ELHINCARLIRLWIAEGFVQYSKRTTSEQVAEEYLNELVDRSLVQVSERDISGRASICQVHDLMHEIVIRKTEELGFGRVLNGVDLSHCSKT-RRITIQRSIDDGAL-ESIKHSKVRTVFLFNIDKLPNSFMKTSIANFKLMKVLDLED--------SPIDYLPEGVGNLFNLHYLSVKNTEVKIIPKSIGNLLSLEILDLKNTLVSELPVEIGNLKKLRYLMG 699
            +  ++  +LI+L +AEGF+Q  +  T E VA  Y+ +LV  SLV+V +R   G+    ++HDL+ E  I+K++EL F   +N  D  H S T RR  +   +DD  L +   ++++R+   F   +   ++++T     KL++VL+L          SP   LP+ +G L +L YL + +T V  +P  I NL  L+ LD        +  ++ NL  LR+L G
Sbjct:  423 DYEVDVEKLIQLLVAEGFIQEDEEMTMEDVARYYIEDLVYISLVEVVKRK-KGKLMSFRIHDLVREFTIKKSKELNF---VNVYDEQHSSTTSRREVVHHLMDDNYLCDRRVNTQMRSFLFFGKRRNDITYVETITLKLKLLRVLNLGGLHFICQGYSPWS-LPDVIGGLVHLRYLGIADTVVNNLPDFISNLRFLQTLDASGNSFERM-TDLSNLTSLRHLTG 640          
BLAST of EY702692 vs. ExPASy Swiss-Prot
Match: R1B14_SOLDE (Putative late blight resistance protein homolog R1B-14 OS=Solanum demissum GN=R1B-14 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 7.213e-20
Identity = 81/223 (36.32%), Postives = 116/223 (52.02%), Query Frame = 1
Query:   67 INCARLIRLWIAEGFVQYSKRTTSEQVAEEYLNELVDRSLVQVSER-DISGRASICQVHDLMHEIVIRKTEELGFGRVLNGVDLS----HCSKTRRITIQRSIDDGALESIKHSKVRTVFLFNIDK-LPNSFMKTS--IANFKLMKVLDLEDS-PIDYLPEGVGNLFNLHYLSVKNTEVKIIPKSIGNLLSLEILDLKNTLVSE-----LPVEIGNLKKLRYL 693
            I+ +RLIRLWI+E F++ S+    E +AE YL  L+ R+LV V++R D  G+   C++HD++ +    +  E  F   +N   +S    +  K         +D+    S   S V +V   N D  L +    TS  + NFK +KVLDLE    ID++P     LF L YLS  + E   IP SI NL +LE L LK+T V       LP  I ++ KLR+L
Sbjct:  803 IDISRLIRLWISESFIKSSEGRRLEDIAEGYLENLIGRNLVMVTQRADSDGKVKACRLHDVLLDFCKERAAEENFLLWINRDQISTKAVYSHKQHAHLAFTEMDNLVEWSASCSLVGSVLFKNPDSYLYSPAFSTSLILLNFKFLKVLDLEHQVVIDFIPT---ELFYLRYLSA-SIEQNSIPSSISNLWNLETLILKSTPVGRHNTLLLPSTIWDMVKLRHL 1021          
BLAST of EY702692 vs. ExPASy Swiss-Prot
Match: R1B16_SOLDE (Putative late blight resistance protein homolog R1B-16 OS=Solanum demissum GN=R1B-16 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.741e-19
Identity = 80/220 (36.36%), Postives = 116/220 (52.73%), Query Frame = 1
Query:   67 INCARLIRLWIAEGFVQYSKRTTSEQVAEEYLNELVDRSLVQVSER-DISGRASICQVHDLMHEIVIRKTEELGFGRVLNGVDLSHC--SKTRRITIQRSIDDGALE-SIKHSKVRTVFLFNIDKLPNSFMKTSIA----NFKLMKVLDLEDS-PIDYLPEGVGNLFNLHYLSVKNTEVKIIPKSIGNLLSLEILDLKNT--LVSELPVEIGNLKKLRYL 693
            I+ +RLIRLWI+E F++ S+    E +AE YL  L+ R+LV V++R D  G+   C++HD++ +    +  E  F   +N    ++   S  R   +  +  D  +E S   S V +V L N  + P S    SI+    NFK +KVLDLE    ID +P     LF L YLS +  E   IP SI NL +LE L LK+       LP  + ++ KLR+L
Sbjct:  801 IDISRLIRLWISESFIKSSEGRRLEDIAEGYLENLIGRNLVMVTQRADSDGKVKACRLHDVLLDFCKERAAEENFLLWINRDQSTNAVYSHKRHAHLAFTEMDSLVEWSASCSLVGSVLLKNYARRPLSSPAFSISHILLNFKFLKVLDLEHQVVIDSIPT---ELFYLRYLSAR-IEQNSIPSSISNLWNLETLILKHVSRCTVLLPSTVWDMVKLRHL 1016          
BLAST of EY702692 vs. ExPASy Swiss-Prot
Match: R1B17_SOLDE (Putative late blight resistance protein homolog R1B-17 OS=Solanum demissum GN=R1B-17 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 6.106e-19
Identity = 77/220 (35.00%), Postives = 111/220 (50.45%), Query Frame = 1
Query:   67 INCARLIRLWIAEGFVQYSKRTTSEQVAEEYLNELVDRSLVQVSER-DISGRASICQVHDLMHEIVIRKTEELGFGRVLNGVDLS----HCSKTRRITIQRSIDDGALESIKHSKVRTVFLFNIDKL---PNSFMKTSIANFKLMKVLDLE-DSPIDYLPEGVGNLFNLHYLSVKNTEVKIIPKSIGNLLSLEILDLKNTLVSE--LPVEIGNLKKLRYL 693
            I+ +RLIRLWI+E F++ S+    E +AE YL  L+ R+LV V++R D  G+   C++HD++ +    +  E  F   +N   +S    +  K         +D+    S   S V +V   N D     P   +   + NFK +KVLDLE    ID++P     LF L YLS  + E   IP SI NL +LE L LK        LP  I ++ KLR+L
Sbjct:  803 IDISRLIRLWISESFIKSSEGRRLEDIAEGYLENLIGRNLVMVTQRADSDGKVKACRLHDVLLDFCKERAAEENFLLWINRDQISTKAVYSHKQHAHLAFTEMDNLVEWSASCSLVGSVLFKNPDSYLYSPAFSISLILLNFKFLKVLDLERQVVIDFIPT---ELFYLRYLSA-SIEQNSIPSSISNLWNLETLILKGISAKTLLLPSTIWDMVKLRHL 1018          
BLAST of EY702692 vs. ExPASy Swiss-Prot
Match: RPP13_ARATH (Disease resistance protein RPP13 OS=Arabidopsis thaliana GN=RPP13 PE=2 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 3.958e-18
Identity = 67/231 (29.00%), Postives = 114/231 (49.35%), Query Frame = 1
Query:   58 ELHINCARLIRLWIAEGFVQYSKRTTSEQVAEEYLNELVDRSLVQVSERDISGRASICQVHDLMHEIVIRKTEELGFGRVLNGVDLSHCSKT-RRITIQRSIDDGALESIKHSKVRTVFLF-NIDKLPNSFMKTSIANFKLMKVLDLEDSPIDYLPEGV-GNLFNLHYLSVKNTEVK--IIPKSIGNLLSLEILDLKNTLVSELPVEIGNLKKLRYLMGYQYNYTSVSSIA 735
            +  I+  +LI L +AEGF+Q  +    E VA  Y+ EL+DRSL++   R+  G+   C++HDL+ ++ I+K++EL F  V N     H S T RR  +       + E  K+ ++R+   F   D L     +T     KL++VLD       +LP  + G+L +L YL +    +    I   I  L  L+ L + +    E  +++  L  LR+++G  +    +  +A
Sbjct:  430 DYEIDLEKLIHLLVAEGFIQGDEEMMMEDVARYYIEELIDRSLLEAVRRE-RGKVMSCRIHDLLRDVAIKKSKELNFVNVYNDHVAQHSSTTCRREVVHHQFKRYSSEKRKNKRMRSFLYFGEFDHLVGLDFET----LKLLRVLDFGSL---WLPFKINGDLIHLRYLGIDGNSINDFDIAAIISKLRFLQTLFVSDNYFIEETIDLRKLTSLRHVIGNFFGGLLIGDVA 652          
BLAST of EY702692 vs. ExPASy Swiss-Prot
Match: RP8L2_ARATH (Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 8.817e-18
Identity = 64/219 (29.22%), Postives = 110/219 (50.23%), Query Frame = 1
Query:   82 LIRLWIAEGFVQ-YSKRTTSEQVAEEYLNELVDRSLVQVSERDISGRASICQVHDLMHEIVIRKTEELGFGRVL-------NGVDLSHCSKTRRITIQRSIDDGALESIKH---SKVRTVFLFNIDKLPNSFMKTSIANFKLMKVLDLEDSPID--YLPEGVGNLFNLHYLSVKNTEVKIIPKSIGNLLSLEILDL--KNTLVSELPVEIGNLKKLRYL 693
            L   W+AEG +  +   +T +   E YL ELV R++V V E  ++ R   CQ+HD+M E+ + K +E  F RV+         ++     ++RR+ +       AL  + H    K R+V +F +++    +         L++VLDL     +   LP  +G+L +L +LS+    V  +P S+GNL  L  L+L   + L+  +P  +  +++LRYL
Sbjct:  439 LFNYWVAEGIITPFHDGSTIQDTGESYLEELVRRNMVVVEESYLTSRIEYCQMHDMMREVCLSKAKEENFIRVVKVPTTTSTTINAQSPCRSRRLVLH---SGNALHMLGHKDNKKARSVLIFGVEE--KFWKPRGFQCLPLLRVLDLSYVQFEGGKLPSSIGDLIHLRFLSLYEAGVSHLPSSLGNLKLLLCLNLGVADRLLVHVPNVLKEMQELRYL 652          
BLAST of EY702692 vs. ExPASy Swiss-Prot
Match: R1C3_SOLDE (Putative late blight resistance protein homolog R1C-3 OS=Solanum demissum GN=R1C-3 PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.376e-17
Identity = 80/230 (34.78%), Postives = 116/230 (50.43%), Query Frame = 1
Query:   67 INCARLIRLWIAEGFVQYSKRTTSEQVAEEYLNELVDRSLVQVSERDIS-GRASICQVHDLMHEIVIRKTEELGFGRVLNGVDL---SHCSKTRRITIQRSIDD--GALE-SIKHSKVRTVFLFNIDKL----PNSFMKTSIA----NFKLMKVLDLEDS-PIDYLPEGVGNLFNLHYLSVKNTEVKIIPKSIGNLLSLEILDLKNTLVSE-----LPVEIGNLKKLRYL 693
            I+ +RLIRLWI+E FV+  +  + E +AE YL  L+ R+LV V++RD S G+   C++HD++ +    +  E  F   +N   +   S C  +       +  D    +E S   S+V +V   N D      P S    SI+    NFK +KVLDLE    ID +P     LF L Y+S  + E   IP SI NL +LE L L  T  +      LP  + ++ KLR+L
Sbjct:  772 IDISRLIRLWISESFVKSCEGRSLEDIAEGYLENLIGRNLVMVTQRDDSDGKVKACRLHDVLLDFCKERAAEENFLLWINRDQITKPSSCVYSHNQHAHLAFTDMKNLVEWSASCSRVGSVLFKNYDPYFAGRPLSSHAFSISRILLNFKFLKVLDLEHQVVIDSIPT---ELFYLRYISA-HIEQNSIPSSISNLWNLETLILNRTSAATGKTLLLPSTVWDMVKLRHL 997          
BLAST of EY702692 vs. ExPASy Swiss-Prot
Match: DRL13_ARATH (Putative disease resistance protein At1g59780 OS=Arabidopsis thaliana GN=At1g59780 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.376e-17
Identity = 73/230 (31.74%), Postives = 118/230 (51.30%), Query Frame = 1
Query:   46 ASARELH-INCARLIRLWIAEGFVQYS--KRTTSEQVAEEYLNELVDRSLVQVSERD-ISGRASICQVHDLMHEIVIRKTEELGFGRVL------NGVDLSHCSKTRRITIQRSIDDGALESIKHSKVRTVFLFNIDKLPNSFMKTSIANFKLMKVLDLEDSPI--DYLPEGVGNLFNLHYLSVKNTEVKIIPKSIGNLLSLEILDLK--NTLVSELPVEIGNLKKLRYL 693
            AS  E H I   RL  +W AEG       +  T   VA+ Y+ ELV R++V +SERD ++ R   CQ+HDLM EI + K +E  F +++      + V     S++RR+ +  +        +K+SK+R++    +     S M ++     L++VLDL+ +      LP  +G L +L YLS+    V  +P S+ NL SL  L+L+  +  +  +P     + +LRYL
Sbjct:  424 ASYPEDHEIEIERLSYVWAAEGITYPGNYEGATIRDVADLYIEELVKRNMV-ISERDALTSRFEKCQLHDLMREICLLKAKEENFLQIVTDPTSSSSVHSLASSRSRRLVVYNTSIFSGENDMKNSKLRSLLFIPVGYSRFS-MGSNFIELPLLRVLDLDGAKFKGGKLPSSIGKLIHLKYLSLYQASVTYLPSSLRNLKSLLYLNLRINSGQLINVPNVFKEMLELRYL 651          
The following BLAST results are available for this feature:
BLAST of EY702692 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
RPM1_ARATH3.343e-2533.49Disease resistance protein RPM1 OS=Arabidopsis tha... [more]
R13L3_ARATH2.830e-2433.03Putative disease resistance RPP13-like protein 3 O... [more]
R13L2_ARATH1.113e-2032.14Putative disease resistance RPP13-like protein 2 O... [more]
R1B14_SOLDE7.213e-2036.32Putative late blight resistance protein homolog R1... [more]
R1B16_SOLDE2.741e-1936.36Putative late blight resistance protein homolog R1... [more]
R1B17_SOLDE6.106e-1935.00Putative late blight resistance protein homolog R1... [more]
RPP13_ARATH3.958e-1829.00Disease resistance protein RPP13 OS=Arabidopsis th... [more]
RP8L2_ARATH8.817e-1829.22Probable disease resistance RPP8-like protein 2 OS... [more]
R1C3_SOLDE4.376e-1734.78Putative late blight resistance protein homolog R1... [more]
DRL13_ARATH4.376e-1731.74Putative disease resistance protein At1g59780 OS=A... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (2 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-701-011-B07-CT.F Sweet orange fruit, development stadium (2 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY702692 ID=EY702692|Name=EY702692|organism=Citrus sinensis|type=EST|length=942bp
CACTGGTACCCCTTGTCACTATTCCGGAATTCTTACTCGACCCACGCGTC
CGCCAGAGAGCTTCACATTAACTGTGCTAGACTTATCCGTTTGTGGATAG
CTGAGGGCTTTGTCCAGTACAGCAAACGCACCACATCTGAACAGGTTGCA
GAAGAATACTTGAATGAGCTCGTTGACAGAAGCTTGGTTCAAGTTTCAGA
GAGAGATATTTCTGGGCGAGCTAGTATCTGCCAAGTTCATGATCTTATGC
ACGAGATCGTCATCAGAAAAACTGAAGAATTGGGCTTCGGTCGTGTGCTG
AACGGAGTGGACTTGAGTCATTGCAGTAAAACTCGACGAATAACTATACA
GAGAAGTATTGATGATGGTGCTTTAGAGAGCATCAAGCACTCGAAGGTCC
GTACTGTTTTTCTTTTCAATATAGATAAGCTGCCCAACTCTTTCATGAAA
ACAAGTATTGCCAATTTCAAGCTCATGAAAGTACTAGATCTGGAAGATTC
TCCTATAGATTACCTTCCTGAAGGAGTGGGAAACTTATTCAATTTACACT
ACTTGAGTGTGAAAAATACAGAAGTAAAAATAATTCCCAAGTCCATTGGA
AATCTTCTCAGTTTAGAGATTTTGGATTTGAAAAACACTTTGGTGAGTGA
ACTTCCAGTAGAGATCGGGAATCTTAAAAAGTTGCGTTATCTAATGGGGT
ATCAGTACAATTATACCTCAGTTTCTAGTATAGCAGGAGCAGCAGTAGCC
AAGCACCCCGGGGGCCTGGGGCGCTAACGGATCTGCAAAAGTTGTCTATT
TTAAAACTGACCCTCAAGCCCTTGACGAGCCTTTTGAACTAAGGCAGTTA
AGAAAATTGGGCTTTAGGCCCACAATGGAAATGGGAAGGATGTGGTGCTT
TGATTGGACATTTGGAAACCCTAAGCCTTTAACGGGTATTGG
back to top