EY702691

Overview
NameEY702691
Unique NameEY702691
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length872
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY702691_ssr695 microsatellite EY702691_ssr695:695..706. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig705 contig Csv1_Contig705:70..943. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY702691 vs. ExPASy Swiss-Prot
Match: C75A1_PINTA (Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 8.356e-20
Identity = 71/202 (35.15%), Postives = 105/202 (51.98%), Query Frame = 1
Query:  223 SLSQKYGPLMQLKLGLNTMVVCSSAEVAELFLKTHDLTFATRPEILAGKHANYDYLVMPGAPYGPHLRQTRKIYKTELLSPKRLAQFEYMRVEERKAFMCXXXXXXXXXXXTPVHLKERVFMFNLAIMSRMLFGKGILRKMKQCCNSQRAHGDRRRSV-----LSFWCLDIGDAIPWLAFLELQGNVQRMKAA*EEID*FYE 813
            +L++KYGP++ L+ G    VV SS+E A+ FLKTHDL FA+RP    GK+  Y++  +  +PYG H R+ RKI   ELL+ KR+  F+++R EE  A M              V++ + +      I+ R      IL + K   N   A G     +     ++   L+IGD IP+L  L+LQG  + +K A    D F E
Sbjct:   68 NLAEKYGPILFLRFGSVPTVVVSSSEKAKHFLKTHDLIFASRPPTSVGKYFFYNFKDIAFSPYGDHWRKMRKICVLELLTSKRIESFKHVRQEELSA-MIHSIWEESESGRIAVNVSKAISTSLANILWR------ILARKKFSDNDLGADGKGFADLVVEVSIAVGSLNIGDFIPYLDCLDLQGIKRALKKANARFDAFAE 262          
BLAST of EY702691 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.091e-19
Identity = 65/197 (32.99%), Postives = 95/197 (48.22%), Query Frame = 1
Query:  223 SLSQKYGPLMQLKLGLNTMVVCSSAEVAELFLKTHDLTFATRPEILAGKHANYDYLVMPGAPYGPHLRQTRKIYKTELLSPKRLAQFEYMRVEERKAFMCXXXXXXXXXXXTPVHLKERVFMFNLAIMSRMLFGKGILRKMKQCCNSQRAHGDRR--RSVLSFWCLDIGDAIPWLAFLELQGNVQRMKAA*EEID*F 807
            +++Q YGPLM LK+G   +VV +SA VA  FLKTHD  F++RP     +H  Y+Y  +  APYGP  R  RKI    L S K L  F ++R +E K                PV L + + +     ++R++ GK +        + Q A         ++     +IGD IP L +L++QG   +MK      D F
Sbjct:   59 AMAQTYGPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVRQDEVKTL----TRALASAGQKPVKLGQLLNVCTTNALARVMLGKRVFADGSGDVDPQAAEFKSMVVEMMVVAGVFNIGDFIPQLNWLDIQGVAAKMKKLHARFDAF 251          
BLAST of EY702691 vs. ExPASy Swiss-Prot
Match: C71BM_ARATH (Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 5.416e-19
Identity = 55/138 (39.86%), Postives = 78/138 (56.52%), Query Frame = 1
Query:  214 SFHSLSQKYGPLMQLKLGLNTMVVCSSAEVAELFLKTHDLTFATRPEILAGKHANYDYLVMPGAPYGPHLRQTRKIYKTELLSPKRLAQFEYMRVEERKAFMCXXXXXXXXXXXTPVHLKERVFMFNLAIMSRMLFGK 627
            SFH LSQ YGP+M L  G+  +VV S+ E AE  LKTHDL   TRP++ A K  +Y+Y  +  A YG   R+ RK+   EL S K+L  F Y+R EE +  +            T V L++ +F +  +I+ R+ FG+
Sbjct:   51 SFHKLSQNYGPVMFLHFGVVPVVVVSTREAAEEVLKTHDLETCTRPKLTATKLFSYNYKDIGFAQYGDDWREMRKLAMLELFSSKKLKAFRYIREEESEVLV--NKLSKSAETRTMVDLRKALFSYTASIVCRLAFGQ 186          
BLAST of EY702691 vs. ExPASy Swiss-Prot
Match: C71BZ_ARATH (Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=CYP71B38 PE=2 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 7.073e-19
Identity = 53/138 (38.41%), Postives = 79/138 (57.25%), Query Frame = 1
Query:  214 SFHSLSQKYGPLMQLKLGLNTMVVCSSAEVAELFLKTHDLTFATRPEILAGKHANYDYLVMPGAPYGPHLRQTRKIYKTELLSPKRLAQFEYMRVEERKAFMCXXXXXXXXXXXTPVHLKERVFMFNLAIMSRMLFGK 627
            SFH +SQ+YGP++ L+LG+  ++V SS E AE  LKTHDL   TRP+  A     Y++  +  AP+G   R+ RKI   EL S K+L  F Y+R EE +  +            + V L++ +F F  +I+ R+ FG+
Sbjct:   51 SFHKISQEYGPVVLLRLGVVPVIVVSSKEGAEEVLKTHDLETCTRPKTAATGLFTYNFKDIGFAPFGDDWREMRKITTLELFSVKKLKSFRYIREEESELLVKKISKSVDETQNSSVDLRKVLFSFTASIICRLAFGQ 188          
BLAST of EY702691 vs. ExPASy Swiss-Prot
Match: C71B5_ARATH (Cytochrome P450 71B5 OS=Arabidopsis thaliana GN=CYP71B5 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 5.988e-18
Identity = 49/138 (35.51%), Postives = 79/138 (57.25%), Query Frame = 1
Query:  214 SFHSLSQKYGPLMQLKLGLNTMVVCSSAEVAELFLKTHDLTFATRPEILAGKHANYDYLVMPGAPYGPHLRQTRKIYKTELLSPKRLAQFEYMRVEERKAFMCXXXXXXXXXXXTPVHLKERVFMFNLAIMSRMLFGK 627
            S H +SQ+YGP+M L  G+  +++ SS E AE  LKTHDL   +RP+ +      Y++  +  APYG + R+ RKI  +EL S K+L  F Y+R +E +  +            + V+L++ +F F  +I+ R+ FG+
Sbjct:   51 SLHKISQEYGPVMLLHFGVVPVIIVSSKEGAEEVLKTHDLETCSRPKTVGSGLFTYNFKDIGFAPYGENWREMRKIAVSELFSQKKLKSFRYIREDESQLLVRKVSKSALETPTSSVNLRKVIFTFAASIICRLSFGQ 188          
BLAST of EY702691 vs. ExPASy Swiss-Prot
Match: F3PH_ARATH (Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.972e-17
Identity = 64/194 (32.99%), Postives = 92/194 (47.42%), Query Frame = 1
Query:  238 YGPLMQLKLGLNTMVVCSSAEVAELFLKTHDLTFATRPEILAGKHANYDYLVMPGAPYGPHLRQTRKIYKTELLSPKRLAQFEYMRVEERKAFMCXXXXXXXXXXXTPVHLKERVFMFNLAIMSRMLFGKGILRKMKQCCNSQRAHGDRRRSVLSFWCL----DIGDAIPWLAFLELQGNVQRMKAA*EEID*F 807
            YGP++ L+LG   +VV +S  VAE FLK HD  FA+RP     KH  Y+Y  +  APYG   R  RKI    L S K L  F+++R EE    +             PV+L + V M  +  + R + G+ +        ++     + R  V     L    +IGD +P L +L+LQG   +MK   +  D F
Sbjct:   64 YGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGHRWRLLRKISSVHLFSAKALEDFKHVRQEE----VGTLTRELVRVGTKPVNLGQLVNMCVVNALGREMIGRRLFG-----ADADHKADEFRSMVTEMMALAGVFNIGDFVPSLDWLDLQGVAGKMKRLHKRFDAF 248          
BLAST of EY702691 vs. ExPASy Swiss-Prot
Match: C71BN_ARATH (Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 5.069e-17
Identity = 50/132 (37.88%), Postives = 75/132 (56.82%), Query Frame = 1
Query:  238 YGPLMQLKLGLNTMVVCSSAEVAELFLKTHDLTFATRPEILAGKHANYDYLVMPGAPYGPHLRQTRKIYKTELLSPKRLAQFEYMRVEERKAFMCXXXXXXXXXXXTPVHLKERVFMFNLAIMSRMLFGKGI 633
            +GP+MQL+LG   +VV SS + AE  LKTHDL   +RPE +A K  +Y++  +  APYG   R  RK+   EL S K+   F Y+R EE    +            +PV+LK+ +F  + +I+ R+ FG+ +
Sbjct:   62 HGPVMQLQLGYVPLVVISSNQAAEEVLKTHDLDCCSRPETIASKTISYNFKDIGFAPYGEEWRALRKLAVIELFSLKKFNSFRYIREEEND--LLVKKLSEASEKQSPVNLKKALFTLSASIVCRLAFGQNL 191          
BLAST of EY702691 vs. ExPASy Swiss-Prot
Match: C82A3_SOYBN (Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.621e-17
Identity = 59/201 (29.35%), Postives = 107/201 (53.23%), Query Frame = 1
Query:  223 SLSQKYGPLMQLKLGLNTMVVCSSAEVAELFLKTHDLTFATRPEILAGKHANYDYLVMPGAPYGPHLRQTRKIYKTELLSPKRLAQFEYMRVEE-----RKAFMCXXXXXXXXXXXTPVHLKERVFMFNLAIMSRMLFGK---GILRKMKQCCNSQRAHGDRRRSVLSFWCLDIGDAIPWLAFLELQGNVQRMKAA*EEID 801
            +L+ KYGPL  +KLG+   +V S+ E+++    T+DL  ++RP+++A +  +Y+   +  APYGP+ R+ RKI   E LS +R+ Q  ++RV E     ++ F             T V +K+ +      ++ RM+ GK   G++  ++    +QR   + R  +       + D +P L +L+L G+ + MKA  +E+D
Sbjct:   66 ALADKYGPLFTIKLGMKPALVLSNWEMSKELFTTNDLAVSSRPKLVAVEVMSYNQAFVGLAPYGPYWRELRKIVTFEFLSNRRIEQRNHIRVSEVRTSIKELFDIWSNGNKNESRYTLVDIKQWLAYLTFNMVVRMVVGKRYFGVMH-VEGKDKAQRFMKNIREFMNLMGTFTVADGVPCLRWLDLGGHEKAMKANAKEVD 265          
BLAST of EY702691 vs. ExPASy Swiss-Prot
Match: C71BL_ARATH (Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.621e-17
Identity = 52/138 (37.68%), Postives = 78/138 (56.52%), Query Frame = 1
Query:  214 SFHSLSQKYGPLMQLKLGLNTMVVCSSAEVAELFLKTHDLTFATRPEILAGKHANYDYLVMPGAPYGPHLRQTRKIYKTELLSPKRLAQFEYMRVEERKAFMCXXXXXXXXXXXTPVHLKERVFMFNLAIMSRMLFGK 627
            SF+ LSQ+YGP+M L+ G+  +VV S+ E AE  LKTHDL   TRP++ A     Y++  +  A YG   R+ RK+   EL S K+L  F Y+R EE +  +            T V L++ +F +  +I+ R+ FG+
Sbjct:   51 SFYKLSQEYGPVMFLRFGVVPVVVFSTKEAAEEVLKTHDLETCTRPKLSATGLFTYNFKDIGFAQYGEDWREMRKLAMLELFSSKKLKAFRYIREEESE--LLVKKVTESAQTQTLVDLRKALFSYTASIVCRLAFGQ 186          
BLAST of EY702691 vs. ExPASy Swiss-Prot
Match: C71B7_ARATH (Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.475e-16
Identity = 52/139 (37.41%), Postives = 76/139 (54.68%), Query Frame = 1
Query:  217 FHSLSQKYGPLMQLKLGLNTMVVCSSAEVAELFLKTHDLTFATRPEILAGKHANYDYLVMPGAPYGPHLRQTRKIYKTELLSPKRLAQFEYMRVEERKAFMCXXXXXXXXXXXTPVHLKERVFMFNLAIMSRMLFGKGI 633
            F +LSQK+GP+M L  G   +VV SS E AE  LKT DL   +RPE +A +  +Y++  +  APYG   +  RK+   ELL+ K+   F Y+R EE    +            +PV+LK+ +F    +I+ R+ FG  I
Sbjct:   56 FRNLSQKFGPVMLLHFGFVPVVVISSKEGAEEALKTQDLECCSRPETVATRMISYNFKDIGFAPYGEEWKALRKLVVMELLNTKKFQSFRYIREEEND--LLIKKLTESALKKSPVNLKKTLFTLVASIVCRLAFGVNI 192          
The following BLAST results are available for this feature:
BLAST of EY702691 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 67
Match NameE-valueIdentityDescription
C75A1_PINTA8.356e-2035.15Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 P... [more]
F3PH_PETHY1.091e-1932.99Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]
C71BM_ARATH5.416e-1939.86Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=C... [more]
C71BZ_ARATH7.073e-1938.41Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=C... [more]
C71B5_ARATH5.988e-1835.51Cytochrome P450 71B5 OS=Arabidopsis thaliana GN=CY... [more]
F3PH_ARATH2.972e-1732.99Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana... [more]
C71BN_ARATH5.069e-1737.88Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=C... [more]
C82A3_SOYBN6.621e-1729.35Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=... [more]
C71BL_ARATH6.621e-1737.68Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=C... [more]
C71B7_ARATH1.475e-1637.41Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CY... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (2 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-701-011-B06-CT.F Sweet orange fruit, development stadium (2 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY702691 ID=EY702691|Name=EY702691|organism=Citrus sinensis|type=EST|length=872bp
CTAAGAATGGAGGATCCTGCTAGTAGTGCCACAGCTGATAATCCTCCAAA
CTCAGTTATGTGGTACTCGGTCCTTGCCTTTTTCCTGCCTGTCCTCCTCT
TGTTCTTTCACCGACATTTTTCTCGCAATAAGCTCAATTACTTGCCACCA
CCCGGTCCAAAGCCATGGCCCCTCATCGGAAATCTCAACCTCCTCGGCGA
GCACCTTCACCTCTCCTTCCATTCTCTCTCCCAAAAATATGGCCCCCTTA
TGCAGCTCAAACTCGGTTTAAACACCATGGTGGTATGCTCATCAGCTGAA
GTAGCAGAACTTTTTCTAAAAACTCATGATCTTACTTTTGCTACTAGGCC
AGAAATTCTTGCAGGGAAACACGCAAACTACGATTATCTAGTTATGCCCG
GTGCACCATACGGTCCACATTTGCGCCAAACTCGTAAAATTTACAAAACG
GAGCTTCTTAGCCCAAAACGTTTAGCACAATTTGAGTACATGAGGGTAGA
GGAAAGAAAAGCATTTATGTGTAAATTGTACAAATTATCATCATCTTCTT
ATTCCACTCCTGTTCATTTGAAAGAGCGTGTTTTCATGTTCAATCTTGCC
ATAATGAGCCGGATGCTGTTCGGAAAAGGTATACTGAGGAAGATGAAACA
ATGTTGTAACTCCCAAAGAGCTCACGGAGATCGTAGAAGAAGTGTTCTTT
CTTTCTGGTGTTTAGATATAGGGGATGCAATTCCATGGCTTGCTTTTCTA
GAATTACAAGGGAATGTTCAGAGAATGAAAGCCGCTTAGGAGGAAATTGA
TTAATTTTATGAACATTGTTTTGGATGAACCCGACCGCCACGGTAAGAAG
AAATTTAAAGAACGTGGGACCC
back to top