EY702469
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY702469 vs. ExPASy Swiss-Prot
Match: SNAK1_SOLTU (Snakin-1 OS=Solanum tuberosum GN=SN1 PE=1 SV=1) HSP 1 Score: 109.383 bits (272), Expect = 5.842e-24 Identity = 45/58 (77.59%), Postives = 48/58 (82.76%), Query Frame = 1 Query: 73 DSKCAERCKQA*VQDRCLNYCGICCEDCKCVPSGTYGNKHEGPCYRDKVNKKGKPKCP 246 DSKC RC +A + DRCL YCGICCE+CKCVPSGTYGNKHE PCYRDK N KGK KCP Sbjct: 31 DSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP 88
BLAST of EY702469 vs. ExPASy Swiss-Prot
Match: GAST1_SOLLC (Protein GAST1 OS=Solanum lycopersicum GN=GAST1 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.130e-12 Identity = 27/56 (48.21%), Postives = 34/56 (60.71%), Query Frame = 1 Query: 79 KCAERCKQA*VQDRCLNYCGICCEDCKCVPSGTYGNKHEGPCYRDKVNKKGKPKCP 246 KC RC + + C+ +C CC C CVP+GTYGNK PCY + K+G PKCP Sbjct: 57 KCTYRCSKTSYKKPCMFFCQKCCAKCLCVPAGTYGNKQSCPCYNNWKTKRGGPKCP 112
BLAST of EY702469 vs. ExPASy Swiss-Prot
Match: RSI1_SOLLC (Protein RSI-1 OS=Solanum lycopersicum GN=RSI-1 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.675e-11 Identity = 25/56 (44.64%), Postives = 32/56 (57.14%), Query Frame = 1 Query: 79 KCAERCKQA*VQDRCLNYCGICCEDCKCVPSGTYGNKHEGPCYRDKVNKKGKPKCP 246 +C RC + C+ +C CC C CVP G YGNK PCY + ++GKPKCP Sbjct: 41 RCTYRCSATSHKKPCMFFCQKCCATCLCVPKGVYGNKQSCPCYNNWKTQEGKPKCP 96 The following BLAST results are available for this feature:
BLAST of EY702469 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY702469 ID=EY702469; Name=EY702469; organism=Citrus sinensis; type=EST; length=422bpback to top |