EY702112

Overview
NameEY702112
Unique NameEY702112
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length871
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY702112 vs. ExPASy Swiss-Prot
Match: RCA_MALDO (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Malus domestica GN=RCA PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 1.350e-70
Identity = 146/247 (59.11%), Postives = 173/247 (70.04%), Query Frame = 3
Query:  111 PLSFNGSGAATSVPSSSFFGTSLKKVSSRIPPSKVPSASFKITAEVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVAHITKNFMCLPNIKGPLILGIWGS*RTGKSFPWELVFAKMGITPTMMSGRKIGKVPRLEKPPNVISEMVPAGNLTFSGKGRMGCPPIDDLEAGPGRLVGPPE*QVTFNWVYA*SCTLVN 851
            P + NGS ++ SVPSS+F G+SLKKV+SR   SKV S S +I A VDE+KQT +DRWKGLA+D SDDQQDITRGKG VDSLFQAP G+GTH+A+MSSY+YIS GLR YN DN +DG YIAPAFMDKLV HITKNFM LPN+K PLILGIWG    GKSF  ELVFAKM I+P MMS  ++      E    +      A ++    KG+M    I+DL+AG GRL G  +  V    V A   TL+N
Sbjct:   15 PPNLNGSSSSASVPSSTFLGSSLKKVNSRFTNSKVSSGSLRIVASVDEDKQTDKDRWKGLAFDTSDDQQDITRGKGKVDSLFQAPQGSGTHFAIMSSYEYISTGLRQYNFDNNMDGYYIAPAFMDKLVVHITKNFMTLPNMKVPLILGIWGGKGQGKSFQCELVFAKMRISPIMMSAGELESGNAGEPAKLIRQRYREAADII--RKGKMCALFINDLDAGAGRLGGTTQYTVNNQMVNA---TLMN 256          
BLAST of EY702112 vs. ExPASy Swiss-Prot
Match: RCA2_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Larrea tridentata GN=RCA2 PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.764e-70
Identity = 150/249 (60.24%), Postives = 177/249 (71.08%), Query Frame = 3
Query:  111 PLSFNGSGAATS-VPSSSFFGTSLKKVSSRIPPSKVPSASFKITA-EVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVAHITKNFMCLPNIKGPLILGIWGS*RTGKSFPWELVFAKMGITPTMMSGRKIGKVPRLEKPPNVISEMVPAGNLTFSGKGRMGCPPIDDLEAGPGRLVGPPE*QVTFNWVYA*SCTLVN 851
            PLS NGSGA  S VPS++FFG+SLKK +++ P  K  S +FKI A E+ E++QT +D+WKGLAYD SDDQQDITRGKG VD+LFQAPM +GTHYAVMSSYDYISQGLR YNLDN +DG YIAPAFMDKLV HITKNF+ LPNIK PLILGIWG    GKSF  ELVFAKMGI P MMS  ++      E    +      A ++    KG+M C  I+DL+AG GR+ G  +  V    V A   TL+N
Sbjct:   15 PLSLNGSGARASLVPSTAFFGSSLKKSAAKFP--KASSGNFKIVAQEISEDQQTDKDKWKGLAYDISDDQQDITRGKGMVDTLFQAPMQSGTHYAVMSSYDYISQGLRQYNLDNNMDGFYIAPAFMDKLVVHITKNFLSLPNIKIPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADII--KKGKMCCLFINDLDAGAGRMGGTTQYTVNNQMVNA---TLMN 256          
BLAST of EY702112 vs. ExPASy Swiss-Prot
Match: RCA1_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Larrea tridentata GN=RCA1 PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.764e-70
Identity = 150/249 (60.24%), Postives = 177/249 (71.08%), Query Frame = 3
Query:  111 PLSFNGSGAATS-VPSSSFFGTSLKKVSSRIPPSKVPSASFKITA-EVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVAHITKNFMCLPNIKGPLILGIWGS*RTGKSFPWELVFAKMGITPTMMSGRKIGKVPRLEKPPNVISEMVPAGNLTFSGKGRMGCPPIDDLEAGPGRLVGPPE*QVTFNWVYA*SCTLVN 851
            PLS NGSGA  S VPS++FFG+SLKK +++ P  K  S +FKI A E+ E++QT +D+WKGLAYD SDDQQDITRGKG VD+LFQAPM +GTHYAVMSSYDYISQGLR YNLDN +DG YIAPAFMDKLV HITKNF+ LPNIK PLILGIWG    GKSF  ELVFAKMGI P MMS  ++      E    +      A ++    KG+M C  I+DL+AG GR+ G  +  V    V A   TL+N
Sbjct:   15 PLSLNGSGARASLVPSTAFFGSSLKKSAAKFP--KASSGNFKIVAQEISEDQQTDKDKWKGLAYDISDDQQDITRGKGMVDTLFQAPMQSGTHYAVMSSYDYISQGLRQYNLDNNMDGFYIAPAFMDKLVVHITKNFLSLPNIKIPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADII--KKGKMCCLFINDLDAGAGRMGGTTQYTVNNQMVNA---TLMN 256          
BLAST of EY702112 vs. ExPASy Swiss-Prot
Match: RCA_PHAAU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus aureus GN=RCA PE=2 SV=2)

HSP 1 Score: 259.61 bits (662), Expect = 1.651e-68
Identity = 150/250 (60.00%), Postives = 173/250 (69.20%), Query Frame = 3
Query:  114 LSFNGSGAATSVPSSSFFGTSLKK-VSSRIPPSKVPSASFKITA---EVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVAHITKNFMCLPNIKGPLILGIWGS*RTGKSFPWELVFAKMGITPTMMSGRKIGKVPRLEKPPNVISEMVPAGNLTFSGKGRMGCPPIDDLEAGPGRLVGPPE*QVTFNWVYA*SCTLVN 851
            L+ NGSGA  S P+S+FFGTSLKK V+SR+P SKV + SFKI A   E++E++QT +DRWKGLAYD SDDQQDITRGKG VD LFQAPM  GTHYAVMSSY+Y+S GLR   LDN  DG YIAPAF+DKLV HITKNFM LPNIK PLILGIWG    GKSF  ELVFAKMGI P MMS  ++      E    +      A +L    KG+M    I+DL+AG GRL G  +  V    V A   TL+N
Sbjct:   16 LNLNGSGAGASAPTSAFFGTSLKKAVASRVPNSKVTNGSFKIVAAEKEIEESQQTNKDRWKGLAYDISDDQQDITRGKGMVDPLFQAPMDAGTHYAVMSSYEYLSTGLR--QLDNIKDGFYIAPAFLDKLVVHITKNFMTLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADLI--AKGKMCALFINDLDAGAGRLGGTTQYTVNNQMVNA---TLMN 258          
BLAST of EY702112 vs. ExPASy Swiss-Prot
Match: RCA_PHAVU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus vulgaris GN=RCA1 PE=2 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 2.156e-68
Identity = 148/250 (59.20%), Postives = 171/250 (68.40%), Query Frame = 3
Query:  114 LSFNGSGAATSVPSSSFFGTSLKKV-SSRIPPSKVPSASFKITA---EVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVAHITKNFMCLPNIKGPLILGIWGS*RTGKSFPWELVFAKMGITPTMMSGRKIGKVPRLEKPPNVISEMVPAGNLTFSGKGRMGCPPIDDLEAGPGRLVGPPE*QVTFNWVYA*SCTLVN 851
            L+ NGSG   S PSS+FFGTSLKKV SSR+P SK+ S SFKI A   E++E +QT+ DRW+GLAYD SDDQQDITRGKG VDSLFQAPM  GTHYAV+SS+ Y+S GLR YN DN  DG YIAPAF+DKLV HI KNFM LPNIK PLILG+WG    GKSF  ELVFAKMGI P MMS  ++      E    +      A +L    KG+M    I+DL+AG GRL G  +  V    V A   TL+N
Sbjct:   16 LNLNGSGGGASGPSSAFFGTSLKKVISSRVPNSKLTSGSFKIVAADKEIEETQQTEGDRWRGLAYDVSDDQQDITRGKGLVDSLFQAPMDAGTHYAVISSHKYLSAGLRQYNFDNIKDGFYIAPAFLDKLVVHIAKNFMTLPNIKVPLILGVWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREASDLI--KKGKMCVLFINDLDAGAGRLGGTTQYTVNNQMVNA---TLMN 260          
BLAST of EY702112 vs. ExPASy Swiss-Prot
Match: RCA_ARATH (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Arabidopsis thaliana GN=RCA PE=1 SV=2)

HSP 1 Score: 253.062 bits (645), Expect = 1.545e-66
Identity = 148/262 (56.49%), Postives = 174/262 (66.41%), Query Frame = 3
Query:   96 MAAAV---------PLSFNGSGA-ATSVPSSSFFGTSLKKVSSRIPPSKVPSASFKITAEVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVAHITKNFMCLPNIKGPLILGIWGS*RTGKSFPWELVFAKMGITPTMMSGRKIGKVPRLEKPPNVISEMVPAGNLTFSGKGRMGCPPIDDLEAGPGRLVGPPE*QVTFNWVYA*SCTLVN 851
            MAAAV         PLS NGSG+ A S P+S+F G  +  VS     +K  + SFK+ A V E+KQT  DRW+GLAYD SDDQQDITRGKG VDS+FQAPMGTGTH+AV+SSY+Y+SQGLR YNLDN +DG YIAPAFMDKLV HITKNF+ LPNIK PLILGIWG    GKSF  ELV AKMGI P MMS  ++      E    +      A +L    KG+M C  I+DL+AG GR+ G  +  V    V A   TL+N
Sbjct:    1 MAAAVSTVGAINRAPLSLNGSGSGAVSAPASTFLGKKVVTVSRFAQSNKKSNGSFKVLA-VKEDKQTDGDRWRGLAYDTSDDQQDITRGKGMVDSVFQAPMGTGTHHAVLSSYEYVSQGLRQYNLDNMMDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGIWGGKGQGKSFQCELVMAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADLI--KKGKMCCLFINDLDAGAGRMGGTTQYTVNNQMVNA---TLMN 256          
BLAST of EY702112 vs. ExPASy Swiss-Prot
Match: RCA1_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 3.442e-66
Identity = 144/251 (57.37%), Postives = 168/251 (66.93%), Query Frame = 3
Query:  111 PLSFNGSGAATSVPSSSFFGTSLKKVSSR-IPPSKVPSASFKITAE---VDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVAHITKNFMCLPNIKGPLILGIWGS*RTGKSFPWELVFAKMGITPTMMSGRKIGKVPRLEKPPNVISEMVPAGNLTFSGKGRMGCPPIDDLEAGPGRLVGPPE*QVTFNWVYA*SCTLVN 851
            PLS N S A TSVPS++FFG +LKKV  + +   KV + S +I AE   VD  KQT  DRWKGL  D SDDQQDITRGKG VDSLFQAP GTGTH+AV+ SY+Y+SQGLR YNLDN +DG YIAPAFMDKLV HITKNF+ LPNIK PLILGIWG    GKSF  ELVF KMGI P MMS  ++ +     +P  +I +           KG M C  I+DL+AG GR+ G  +  V    V A   TL+N
Sbjct:   15 PLSLNNSVAGTSVPSTAFFGKTLKKVYGKGVSSPKVTNKSLRIVAEQIDVDPKKQTDSDRWKGLVQDFSDDQQDITRGKGMVDSLFQAPTGTGTHHAVLQSYEYVSQGLRQYNLDNKLDGFYIAPAFMDKLVVHITKNFLKLPNIKVPLILGIWGGKGQGKSFQCELVFRKMGINPIMMSAGEL-ESGNAGEPAKLIRQRYREA-AEIIRKGNMCCLFINDLDAGAGRMGGTTQYTVNNQMVNA---TLMN 260          
BLAST of EY702112 vs. ExPASy Swiss-Prot
Match: RCA2_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Nicotiana tabacum GN=RCA PE=2 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 1.107e-64
Identity = 140/255 (54.90%), Postives = 168/255 (65.88%), Query Frame = 3
Query:   99 AAAVPLSFNGSGAATSVPSSSFFGTSLKKVSSR-IPPSKVPSASFKITAE---VDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVAHITKNFMCLPNIKGPLILGIWGS*RTGKSFPWELVFAKMGITPTMMSGRKIGKVPRLEKPPNVISEMVPAGNLTFSGKGRMGCPPIDDLEAGPGRLVGPPE*QVTFNWVYA*SCTLVN 851
            A   PLS N S A TSVPS++FFG +LKKV  + +   KV + S +I AE    D  KQT  DRWKGL  D SDDQQDI RGKG VDSLFQAP GTGTH+AV+ SY+Y+SQGLR YN+DNT+DG YIAP+FMDKLV HITKNF+ LPNIK PLILG+WG    GKSF  ELVF KMGI P MMS  ++ +     +P  +I +           KG + C  I+DL+AG GR+ G  +  V    V A   TL+N
Sbjct:   11 ANKAPLSLNNSVAGTSVPSTAFFGKTLKKVYGKGVSSPKVTNRSLRIAAEEKDADPKKQTYSDRWKGLVQDFSDDQQDIARGKGMVDSLFQAPTGTGTHHAVLQSYEYVSQGLRQYNMDNTLDGFYIAPSFMDKLVVHITKNFLKLPNIKVPLILGVWGGKGQGKSFQCELVFRKMGINPIMMSAGEL-ESGNAGEPAKLIRQRYREA-AEIIRKGNICCLFINDLDAGAGRMGGTTQYTVNNQMVNA---TLMN 260          
BLAST of EY702112 vs. ExPASy Swiss-Prot
Match: RCA_CUCSA (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 1.446e-64
Identity = 138/254 (54.33%), Postives = 167/254 (65.75%), Query Frame = 3
Query:   90 SLMAAAVPLSFNGSGAATSVPSSSFFGTSLKKVSSRIPPSKVPSASFKITAEVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVAHITKNFMCLPNIKGPLILGIWGS*RTGKSFPWELVFAKMGITPTMMSGRKIGKVPRLEKPPNVISEMVPAGNLTFSGKGRMGCPPIDDLEAGPGRLVGPPE*QVTFNWVYA*SCTLVN 851
            S + A    + N S     VP+S+F G+ LK VSSR   SK+ + +FKI AE DE KQT++D+W+GLA+D SDDQQDITRGKG  D LFQAPMGTGTH AV+SSY+YIS GLR Y+ DN +DG YIAPAFMDKL  HI KNF+ LPNIK PLILG+WG    GKSF  ELVFAKMGI P MMS  ++      E    +      A ++    KG+M C  I+DL+AG GRL G  +  V    V A   TL+N
Sbjct:    6 STIGAVNRTTLNNSNYGGLVPNSAFLGSRLK-VSSRFTTSKMVTGNFKIVAEQDEEKQTEKDKWRGLAFDTSDDQQDITRGKGLADPLFQAPMGTGTHNAVLSSYEYISAGLRDYSYDNNVDGFYIAPAFMDKLTVHIVKNFLTLPNIKVPLILGVWGGKGQGKSFQCELVFAKMGINPIMMSAGELESGNAGEPAKLIRQRYREAADII--KKGKMCCLFINDLDAGAGRLGGTTQYTVNNQMVNA---TLMN 253          
BLAST of EY702112 vs. ExPASy Swiss-Prot
Match: RCA_SOLPN (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Solanum pennellii PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 9.374e-64
Identity = 139/253 (54.94%), Postives = 171/253 (67.59%), Query Frame = 3
Query:   99 AAAVPLSFNGSGAATSVPSSSFFGTSLKKVSSR-IPPSKVPSASFKITA-EVDENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLVAHITKNFMCLPNIKGPLILGIWGS*RTGKSFPWELVFAKMGITPTMMSGRKIGKVPRLEKPPNVISEMVPAGNLTFSGKGRMGCPPIDDLEAGPGRLVGPPE*QVTFNWVYA*SCTLVN 851
            A+  PLS N S A TSVPS++FFG SLKKV ++ +   KV + + ++ A EVDE   TK+DRWKGL  + SDDQQDI RGKG VDSLFQAP GTGTH+A+M+SY+Y+SQ L+TY LDN +DG YIAPAFMDKLV HITKNF+ LPNIK PLILG+WG    GKSF  ELVF KMGI P MMS  ++ +     +P  +I +           KG M C  I+DL+AG GR+ G  +  V    V A   TL+N
Sbjct:   11 ASKAPLSLNNSVAGTSVPSTAFFGKSLKKVYAKGVSSPKVSNRNLRVVAQEVDE---TKEDRWKGLYDNTSDDQQDIARGKGLVDSLFQAPTGTGTHHAIMNSYEYVSQALKTYQLDNKLDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGVWGGKGQGKSFQCELVFRKMGINPIMMSAGEL-ESGNAGEPAKLIRQRYREA-AEIIRKGNMCCLFINDLDAGAGRMGGTTQYTVNNQMVNA---TLMN 255          
The following BLAST results are available for this feature:
BLAST of EY702112 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
RCA_MALDO1.350e-7059.11Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_LARTR1.764e-7060.24Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA1_LARTR1.764e-7060.24Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAAU1.651e-6860.00Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAVU2.156e-6859.20Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ARATH1.545e-6656.49Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA1_TOBAC3.442e-6657.37Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_TOBAC1.107e-6454.90Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_CUCSA1.446e-6454.33Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_SOLPN9.374e-6454.94Ribulose bisphosphate carboxylase/oxygenase activa... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (2 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-701-001-B12-CT.F Sweet orange fruit, development stadium (2 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY702112 ID=EY702112|Name=EY702112|organism=Citrus sinensis|type=EST|length=871bp
CACGCACTCTTCGCATTGCTTCGCTTTCCTTTGCCTGCATTACAGCGTGA
CCCTTTAGCTACTTCAATCACAGCCGTCCAATTCTCGCTAGCCTAATGGC
TGCTGCTGTACCGTTGAGCTTCAATGGCTCTGGTGCTGCAACCTCTGTCC
CAAGCTCATCTTTCTTTGGCACCAGCTTGAAGAAGGTAAGCTCAAGGATC
CCCCCATCCAAGGTCCCTTCTGCGAGCTTCAAGATTACTGCTGAAGTCGA
TGAGAACAAGCAGACCAAGCAGGACAGATGGAAGGGCCTTGCCTACGACG
AATCTGATGACCAACAAGACATCACCAGAGGAAAAGGTGCTGTGGACTCT
CTGTTCCAAGCCCCCATGGGAACCGGAACTCACTATGCTGTCATGAGTTC
TTATGACTACATCAGCCAAGGTCTCCGCACATACAACTTGGACAACACGA
TCGACGGTCTCTACATTGCCCCTGCTTTCATGGACAAGCTTGTTGCTCAC
ATCACCAAGAACTTCATGTGCCTGCCCAACATCAAGGGTCCTCTCATCTT
GGGTATTTGGGGGAGCTAACGGACAGGAAAATCCTTCCCATGGGAGCTTG
TTTTCGCCAAAATGGGCATCACCCCAACTATGATGAGCGGCCGAAAAATT
GGAAAAGTGCCTAGGCTGGAAAAACCCCCTAATGTGATCAGCGAAATGGT
ACCGGCGGGGAATCTGACCTTTTCTGGGAAGGGAAGAATGGGCTGCCCCC
CGATCGATGATCTTGAAGCAGGACCTGGTCGCTTGGTGGGCCCCCCCGAG
TGACAGGTAACGTTCAATTGGGTATATGCCTAGTCGTGTACGTTGGTGAA
TCCCAAGTTGGGGGCGACCCC
back to top