EY702110

Overview
NameEY702110
Unique NameEY702110
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length916
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY702110 vs. ExPASy Swiss-Prot
Match: ATG26_NEUCR (Sterol 3-beta-glucosyltransferase OS=Neurospora crassa GN=atg-26 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 9.370e-25
Identity = 80/287 (27.87%), Postives = 129/287 (44.95%), Query Frame = 1
Query:   13 KSMSRHDLKLDRLSEREKKKLIVELVRIQNDGTVEVDLDKSTPVASEFLEFQPVE----------GPPIILDD--TSFSDSKKSIPRLNIAILVVGTRGDVQPFLAMAKRLQEFGHRVRLATHANFRTFVRSAGVDFFPLGGDPRVLAGYMARNKGLIPSGPGEISIQ-RKQIKAIIESLLPACTDPDIETGVPFRSQAIIANPPAYGHAHVAEALGVPIHIFFTMPWTPTYEFPPPLARVPQSAGYC---LSYIIEDLLIWGGLRNYYYGFRQRKLKLPPIDTSEL 825
            K+ +R D  +  +   +  + + E   ++     E + D      +E      +E           P I+ DD   SF + K S P + I  L +G+RGDVQP++A+ KRL E GHR ++ TH  F+ ++ S G++F P+ GDP  L      N     +   E + + R  +  ++ S   AC   D+          +I +P A    H+AEALG+P    FTMPWT T  +P       Q  G     ++Y++ D + W    +    +R + L LP     +L
Sbjct:  925 KAENRDDCAITIIQSLDAARYLAESQEVEEAQAAEAERDALNQARNEEFPDHEIELPRQASGVSDAPTILFDDPKASFLNFKPSEP-MRITCLTIGSRGDVQPYIALCKRLLEEGHRPKIVTHREFKDWIESHGIEFGPVEGDPSELMRICIENGTFTYAFLREANSKFRGWLDELLTSAWEACQGSDL----------LIESPSAMAGIHIAEALGIPYFRAFTMPWTRTRAYPHAFIMPGQKMGGAYNYITYVMFDNVFWKATAHQVNRWRNKYLGLPNTSLEKL 1200          
BLAST of EY702110 vs. ExPASy Swiss-Prot
Match: ATG26_PENCW (Sterol 3-beta-glucosyltransferase OS=Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) GN=atg26 PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.224e-24
Identity = 88/281 (31.32%), Postives = 129/281 (45.91%), Query Frame = 1
Query:   16 SMSRHDLKLDRLSEREKKKLIVELVRIQNDGTVEVDLDKSTPVASEFLEFQPVEG---PPIILDDTS-----FSDSKKSIPR------LNIAILVVGTRGDVQPFLAMAKRLQEFGHRVRLATHANFRTFVRSAGVDFFPLGGDPRVLAGYMARNKGLIPSGPGEISIQ-RKQIKAIIESLLPACTDPDIETGVPFRSQAIIANPPAYGHAHVAEALGVPIHIFFTMPWTPTYEFPPPLARVPQS----AGYCLSYIIEDLLIWGGLRNYYYGFRQRKLKL 801
            S SR D  +      E  K +VE   +  D   EV+  K+     E       EG   PP + +D+S     F D + SI        L I  L +G+RGDVQP++A+ K L   GH+ ++ATHA F  ++R  G+DF P+ GDP  L      N     S   E S++ R  I  ++ S    C   D+          +I +P A    H+AEAL +P    FTMPWT T  +P   A VP++    A   ++Y++ D + W  +      +R  +L L
Sbjct:  796 SDSRDDCAVTLHQNLESVKFLVESGLLAEDERDEVEAAKAEHRMLEEARLDSPEGHDAPPTLTEDSSEIHPFFDDPRASIINFKPPEPLRITCLTIGSRGDVQPYIALCKGLLAEGHKPKIATHAEFEPWIRKHGIDFAPVDGDPAELMRICVENGMFTYSFLREASLKFRGWIDDLLSSAWIGCQGSDL----------LIESPSAMAGIHIAEALRIPYFRGFTMPWTRTRAYPHAFA-VPENRMGGAYNYITYVMFDNIFWKAIAGQVNRWRNNELGL 1065          
BLAST of EY702110 vs. ExPASy Swiss-Prot
Match: ATG26_CANAL (Sterol 3-beta-glucosyltransferase OS=Candida albicans GN=ATG26 PE=3 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 6.074e-24
Identity = 70/215 (32.56%), Postives = 109/215 (50.70%), Query Frame = 1
Query:  184 PIILDDTSFSDSK-KSIPRLNIAILVVGTRGDVQPFLAMAKRLQEFGHRVRLATHANFRTFVRSAGVDFFPLGGDPRVLAGYMARNKGLIPSGPGEISIQRKQIKAIIESLL----PACTDPDIETGVPFRSQAIIANPPAYGHAHVAEALGVPIHIFFTMPWTPTYEFPPPLARVPQSAGYCLSYIIEDL---LIWGGLRNYYYGFRQRKLKLP 804
            PIIL+D+ F  ++ +     NI +L +G+RGDVQP++A+ K L + GH V +ATHA F  ++++ G+ F  + GDP  L  +M  +  +     G +   +++ ++ I  LL     AC   DI          +I +P A    H+AEALG+P    FTMPWT T  +P       Q  G   +Y+   L   + W G+      +R  +L LP
Sbjct:  996 PIILEDSPFFKTELRPSTSYNITLLTIGSRGDVQPYIALGKGLVKEGHNVTIATHAEFGDWIKTFGLGFKEIAGDPAELMSFMVTHNSM---SVGFLKNAQQKFRSWISKLLTTSWEACQGSDI----------LIESPSAMSGIHIAEALGIPYFRAFTMPWTRTRAYPHAFFVPEQKKGGSYNYLTHVLFENIFWKGISGQVNKWRVEELDLP 1197          
BLAST of EY702110 vs. ExPASy Swiss-Prot
Match: ATG26_PICPG (Sterol 3-beta-glucosyltransferase OS=Pichia pastoris (strain GS115) GN=ATG26 PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 2.308e-23
Identity = 69/222 (31.08%), Postives = 113/222 (50.90%), Query Frame = 1
Query:  184 PIILDDTSFSDSK-KSIPRLNIAILVVGTRGDVQPFLAMAKRLQEFGHRVRLATHANFRTFVRSAGVDFFPLGGDPRVLAGYMARNKGLIPSGPGEISIQRKQ----IKAIIESLLPACTDPDIETGVPFRSQAIIANPPAYGHAHVAEALGVPIHIFFTMPWTPTYEFPPPLARVPQSAG---YCLSYIIEDLLIWGGLRNYYYGFRQRKLKLPPIDTSEL 825
            PIIL++  +S S+ +S  R    +L +G+RGDVQP++++AK L    H+V++ TH  F+ +V S G++F  + G+P  L   M  +K L     G +   +++    I  +++S   AC D D+          +I +P A    H+AE L +P    FTMPWT T  +P       Q  G     L++II + + W G+      +R++ L LP  +   L
Sbjct:  742 PIILEENQYSTSEIRSKRRYKFVLLTIGSRGDVQPYISLAKGLLAENHKVKIVTHEEFKPWVESYGIEFATIAGNPAELMSLMVTHKSL---SVGFLKEAKEKFTGWIGELLQSSWDACQDADV----------LIESPSAMAGIHIAEKLQIPYFRAFTMPWTRTRAYPHAFVVPEQKRGGSYNYLTHIIFENVFWKGISGEVNKWREQVLMLPKTNLERL 950          
BLAST of EY702110 vs. ExPASy Swiss-Prot
Match: ATG26_LEPMC (Sterol 3-beta-glucosyltransferase OS=Leptosphaeria maculans GN=ATG26 PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 2.308e-23
Identity = 79/251 (31.47%), Postives = 122/251 (48.61%), Query Frame = 1
Query:  121 DLDKSTPVASEFLEFQPVEGPPIILDD--TSFSDSKKSIPRLNIAILVVGTRGDVQPFLAMAKRLQEFGHRVRLATHANFRTFVRSAGVDFFPLGGDPRVLAGYMARNKGLIPSGPGEISIQ-RKQIKAIIESLLPACTDPDIETGVPFRSQAIIANPPAYGHAHVAEALGVPIHIFFTMPWTPTYEFPPPLARVPQSAG---YCLSYIIEDLLIWGGLRNYYYGFRQRKLKLPPIDTSELPTDL--FLFS 849
            ++DK T   SE +     +  P+I DD   SF D K   P L I  L +G+RGDVQP++A+ K L + GH+ R+ATHA F  +VR  G+DF P+ G+P  L      +     +   E + + R  +  +  S   AC   D+          +I +P      H+AEAL +P    FTMPWT T  +P   + + +  G     ++YI  D + W  +      +R+R+L L     S++   L  FL++
Sbjct:  918 NVDK-TKNLSEIVRAAADDRIPLIFDDPLASFVDFKPPEP-LTIVCLTIGSRGDVQPYIALCKELLKEGHKPRIATHAEFEPWVRKHGIDFAPVDGNPAELMRICVEHGMFTYNFMKEANSKFRGWLDDVCSSSWRACQGADV----------LIESPSTMAGIHIAEALEIPYFRAFTMPWTRTRAYPHAFSVLEKKMGGGYNSITYITFDTIFWTAISGQINKWRRRELGLQNTSQSKMQASLRPFLYN 1156          
BLAST of EY702110 vs. ExPASy Swiss-Prot
Match: ATG26_PHANO (Sterol 3-beta-glucosyltransferase OS=Phaeosphaeria nodorum GN=ATG26 PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 3.014e-23
Identity = 80/269 (29.74%), Postives = 127/269 (47.21%), Query Frame = 1
Query:   76 IVELVRIQNDGTVEVDLDKSTPVASEFLEFQPVEGPPIILDD--TSFSDSKKSIPRLNIAILVVGTRGDVQPFLAMAKRLQEFGHRVRLATHANFRTFVRSAGVDFFPLGGDP----RVLAGYMARNKGLIPSGPGEISIQRKQIKAIIESLLPACTDPDIETGVPFRSQAIIANPPAYGHAHVAEALGVPIHIFFTMPWTPTYEFPPPLARVPQSAG---YCLSYIIEDLLIWGGLRNYYYGFRQRKLKLPPIDTSELPTDL--FLFS 849
            +++  R Q+D   ++D+ +    A         +  P+I DD   SF D K   P L I  L +G+RGDVQP++++ K L + GH+ R+ATHA F  +VR  G+DF P+ GDP    R+   +     G I     +    R  +  +  S   AC   D+          +I +P      HVAEAL +P    FTMPW+ T  +P   + +    G     ++Y + D L W  +      +R+R+L L     S++  +L  FL++
Sbjct:  905 LLQQAREQSDTHEQIDVSEIARAADH-------DRIPLIFDDPLASFVDFKPPEP-LTIVCLTIGSRGDVQPYISLCKELLKEGHKARIATHAEFEPWVRKHGIDFAPVDGDPAELMRICVEHGMFTYGFIKEANSKF---RGWLDDVCSSSWRACQGADV----------LIESPSTMAGIHVAEALEIPYFRAFTMPWSRTRAYPHAFSVLENKMGGGYNNMTYQLFDKLFWTAISAQVNKWRRRELGLQNTSQSKMQANLRPFLYN 1152          
BLAST of EY702110 vs. ExPASy Swiss-Prot
Match: ATG26_ASPOR (Sterol 3-beta-glucosyltransferase OS=Aspergillus oryzae GN=atg26 PE=3 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 3.014e-23
Identity = 80/256 (31.25%), Postives = 125/256 (48.83%), Query Frame = 1
Query:   49 LSEREKKKLIVELVRIQNDGTVEVDLDKSTPVASEFLEFQPVEGPPIILDDTSFSDSKKSIPRLNIAILVVGTRGDVQPFLAMAKRLQEFGHRVRLATHANFRTFVRSAGVDFFPLGGDPRVLAGYMARNKGLIPSGPGEISIQ-RKQIKAIIESLLPACTDPDIETGVPFRSQAIIANPPAYGHAHVAEALGVPIHIFFTMPWTPTYEFPPPLARVPQS----AGYCLSYIIEDLLIWGGLRNYYYGFRQRKLKL 801
            L+E+EK +  +E  + ++    E  LD +    S     +  E  PI  D  +   + K    L I  L +G+RGDVQP++A+ K L   GH+ ++ATHA F  +VR  G+DF P+ GDP  L      N     S   E S + R  I  ++ S   +C D D+          +I +P A    H+AEAL +P    FTMPW+ T  +P   A VP++    A   ++Y++ D + W  +      +R+++L L
Sbjct:  831 LAEQEKDE--IESAQAEHRMLQEARLDGAGEHDSHASVNESSELHPIFDDPRASIINFKPSESLRITCLTIGSRGDVQPYIALCKGLLAEGHKPKIATHAEFEPWVRQHGIDFAPVDGDPAELMRICVENGMFTYSFLKEASTKFRGWIDDLLSSAWASCQDSDL----------LIESPSAMAGIHIAEALRIPYFRAFTMPWSRTRAYPHAFA-VPENKMGGAYNYITYVMFDTVFWKAIAGQVNRWRKKQLGL 1073          
BLAST of EY702110 vs. ExPASy Swiss-Prot
Match: ATG26_ASPTN (Sterol 3-beta-glucosyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg26 PE=3 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 3.937e-23
Identity = 72/211 (34.12%), Postives = 105/211 (49.76%), Query Frame = 1
Query:  184 PIILDDTSFSDSKKSIPRLNIAILVVGTRGDVQPFLAMAKRLQEFGHRVRLATHANFRTFVRSAGVDFFPLGGDPRVLAGYMARNKGLIPSGPGEISIQ-RKQIKAIIESLLPACTDPDIETGVPFRSQAIIANPPAYGHAHVAEALGVPIHIFFTMPWTPTYEFPPPLARVPQ----SAGYCLSYIIEDLLIWGGLRNYYYGFRQRKLKL 801
            PI  D  +   + K    L I  L +G+RGDVQP++A+ K L   GHR ++ATHA F  ++R  G+DF P+ GDP  L      N     S   E S++ R  I  ++ S   +C D D+          +I +P A    H+AEAL +P    FTMPWT T  +P   A VP+     A   ++Y++ D + W  +      +RQ +L L
Sbjct:  880 PIFDDPRASIINFKPTESLRITCLTIGSRGDVQPYIALCKGLLAEGHRPKIATHAEFEPWIRKHGIDFAPVEGDPAELMRICVENGMFTYSFLKEASMKFRGWIDDLLSSAWRSCQDSDL----------LIESPSAMAGIHIAEALRIPYFRAFTMPWTRTRAYPHAFA-VPEHKMGGAYNYITYVMFDNVFWKAIAGQVNRWRQSELGL 1079          
BLAST of EY702110 vs. ExPASy Swiss-Prot
Match: ATG26_DEBHA (Sterol 3-beta-glucosyltransferase OS=Debaryomyces hansenii GN=ATG26 PE=3 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 1.145e-22
Identity = 67/212 (31.60%), Postives = 109/212 (51.42%), Query Frame = 1
Query:  184 PIILDDTSFSDSK-KSIPRLNIAILVVGTRGDVQPFLAMAKRLQEFGHRVRLATHANFRTFVRSAGVDFFPLGGDPRVLAGYMARNKGLIPSGPGEISIQ-RKQIKAIIESLLPACTDPDIETGVPFRSQAIIANPPAYGHAHVAEALGVPIHIFFTMPWTPTYEFPPPLARVPQSAGYCLSYIIE---DLLIWGGLRNYYYGFRQRKLKLP 804
            PI+L+D+ F  ++ +     N  +L +G+RGDVQP++A+ K L   GH V +ATH++F  ++   G+ F  + G+P  L   M  +  +  S   E S + R  I+ ++++   AC   DI          +I +P A   AH+AEALG+P    FTMPWT T  +P       +  G   +YI     + ++W G+ +    +R+  L LP
Sbjct: 1029 PIVLEDSPFYKTEIRPSTSFNFTLLTIGSRGDVQPYIALGKGLLNEGHNVTIATHSDFEEWIVGHGIKFKTIAGNPVELMSLMVTHGSMSLSFLKEASSKFRGWIQELLDTSWKACQGSDI----------LIESPSAMVGAHIAEALGIPYIRAFTMPWTRTRAYPHAFIVPDKKKGGSYNYITHLMFETVLWKGISSQVNKWRRESLGLP 1230          
BLAST of EY702110 vs. ExPASy Swiss-Prot
Match: ATG26_SCLS1 (Sterol 3-beta-glucosyltransferase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg26 PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.496e-22
Identity = 76/236 (32.20%), Postives = 116/236 (49.15%), Query Frame = 1
Query:  205 SFSDSKKSIPR------LNIAILVVGTRGDVQPFLAMAKRLQEFGHRVRLATHANFRTFVRSAGVDFFPLGGDPRVLAGYMARNKGLIPSGPGEISIQ-RKQIKAIIESLLPACTDPDIETGVPFRSQAIIANPPAYGHAHVAEALGVPIHIFFTMPWTPTYEFPPPLARVPQ-----SAGYCLSYIIEDLLIWGGLRNYYYGFRQRKLKLPPIDTSELPTD----LFLFSNRLIV 864
            SF D + SI        L I  L +G+RGDVQP++A+ K L   GH+ ++ATH  F+ ++ S G++F P+ GDP  L      N     S   E S + R  I  ++ S   AC + DI          +I +P A    H+AEAL +P    FTMPWT T  +P   A VP+     S  Y ++Y++ D + W  +      +RQ++L L      ++  +    L+ FS  ++V
Sbjct:  923 SFDDPRASILNFKPTEPLRITCLTIGSRGDVQPYIALCKGLMAEGHQTKIATHLEFKEWIESHGIEFAPVDGDPAELMRICVENGMFTVSFLKEASSKFRGWIDDLLSSSWRACQNSDI----------LIESPSAMAGIHIAEALRIPYFRAFTMPWTRTRAYPHAFA-VPEHKLGGSYNY-VTYLMFDTVFWRAISGQVNRWRQKELNLQATGLEKMQPNKVPFLYNFSPSVVV 1146          
The following BLAST results are available for this feature:
BLAST of EY702110 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
ATG26_NEUCR9.370e-2527.87Sterol 3-beta-glucosyltransferase OS=Neurospora cr... [more]
ATG26_PENCW1.224e-2431.32Sterol 3-beta-glucosyltransferase OS=Penicillium c... [more]
ATG26_CANAL6.074e-2432.56Sterol 3-beta-glucosyltransferase OS=Candida albic... [more]
ATG26_PICPG2.308e-2331.08Sterol 3-beta-glucosyltransferase OS=Pichia pastor... [more]
ATG26_LEPMC2.308e-2331.47Sterol 3-beta-glucosyltransferase OS=Leptosphaeria... [more]
ATG26_PHANO3.014e-2329.74Sterol 3-beta-glucosyltransferase OS=Phaeosphaeria... [more]
ATG26_ASPOR3.014e-2331.25Sterol 3-beta-glucosyltransferase OS=Aspergillus o... [more]
ATG26_ASPTN3.937e-2334.12Sterol 3-beta-glucosyltransferase OS=Aspergillus t... [more]
ATG26_DEBHA1.145e-2231.60Sterol 3-beta-glucosyltransferase OS=Debaryomyces ... [more]
ATG26_SCLS11.496e-2232.20Sterol 3-beta-glucosyltransferase OS=Sclerotinia s... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (2 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-701-001-B10-CT.F Sweet orange fruit, development stadium (2 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY702110 ID=EY702110|Name=EY702110|organism=Citrus sinensis|type=EST|length=916bp
CCACGCGTCCGGAAGTCGATGTCGCGGCATGACCTGAAATTGGATAGACT
GTCAGAGCGTGAAAAGAAAAAGCTGATTGTGGAACTAGTCAGGATTCAAA
ATGACGGGACTGTAGAAGTGGATTTAGATAAAAGTACACCTGTAGCTTCA
GAGTTTTTGGAATTTCAACCTGTCGAAGGGCCACCTATCATTTTGGATGA
CACCAGTTTTTCTGATTCCAAGAAATCGATCCCAAGATTGAATATTGCCA
TACTTGTGGTTGGAACAAGAGGAGATGTACAGCCATTTCTGGCTATGGCC
AAGAGACTTCAGGAGTTTGGTCATCGTGTTAGGTTGGCAACCCATGCTAA
CTTCAGGACTTTTGTAAGGTCAGCCGGGGTAGACTTCTTTCCTTTGGGCG
GTGATCCTCGGGTTTTGGCAGGATATATGGCACGGAATAAAGGTCTGATC
CCTTCTGGACCGGGAGAAATATCGATACAAAGAAAGCAGATAAAGGCCAT
TATAGAATCTCTTCTTCCAGCATGCACAGATCCGGATATAGAAACTGGTG
TACCTTTTAGATCTCAAGCAATTATTGCAAATCCTCCTGCTTATGGGCAT
GCCCATGTTGCTGAAGCTCTTGGTGTACCCATTCACATTTTCTTTACGAT
GCCATGGACGCCAACTTATGAATTTCCTCCTCCGCTGGCACGTGTACCCC
AAAGTGCTGGATATTGCCTTTCTTATATAATTGAGGATTTGCTGATATGG
GGGGGCCTTAGGAACTATTATTATGGCTTCAGGCAAAGGAAGTTGAAGCT
TCCCCCTATTGATACTTCAGAACTACCCACGGATCTTTTTCTCTTTTCCA
ACAGGCTTATTGTGGAGTCCCATCTTTGTGCCCAAGCCAAGAGATTGGGG
CTCCTTTTGTGTTCGT
back to top