EY702098

Overview
NameEY702098
Unique NameEY702098
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length791
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11894 contig Csv1_Contig11894:832..1622. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY702098 vs. ExPASy Swiss-Prot
Match: TF3A_HUMAN (Transcription factor IIIA OS=Homo sapiens GN=GTF3A PE=1 SV=3)

HSP 1 Score: 73.9442 bits (180), Expect = 1.104e-12
Identity = 45/137 (32.85%), Postives = 69/137 (50.36%), Query Frame = 2
Query:   11 GKVFKYASKLRQHEDSHVNLDSVEAFCSEPGCMKYFTNKQCLEAHIRSCH-QYIPCEICGSMQLKKN-IKRHVRTHEA-RDLSERIKCQFKGCLLSFSTNSNLRQHVKAVHYEIKPFACSFFGCGMRFAFKHVRDNH 412
            GK F   SKL++H  +H      E +  + GC         L  H+R  H + I CE+C     +K+ +K+H++TH   RD+    +C  +GC  +++T  NL+ H+ + H E +PF C   GCG  FA K     H
Sbjct:  170 GKHFASPSKLKRHAKAH------EGYVCQKGCSFVAKTWTELLKHVRETHKEEILCEVCRKTFKRKDYLKQHMKTHAPERDVC---RCPREGCGRTYTTVFNLQSHILSFHEESRPFVCEHAGCGKTFAMKQSLTRH 297          
BLAST of EY702098 vs. ExPASy Swiss-Prot
Match: TF3A_SCHPO (Transcription factor IIIA OS=Schizosaccharomyces pombe GN=sfc2 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.477e-12
Identity = 45/147 (30.61%), Postives = 65/147 (44.22%), Query Frame = 2
Query:   11 GKVFKYASKLRQHEDSHVNLDSVEAFCSEPGCMKYFTNKQCLEAHIR--------SCHQYIPCEICGSMQLKKNIKRHVRTHEARDLSERIKCQFKGCLLSFSTNSNLRQHVKAVHYEIKPFACSFFGCGMRFAFKHVRDNHEKSGH 427
            GK +   S L QH  +H N       C   GC K F  K  L+ H R        SCH Y  C+       +++++RH+  H      +   C ++GC   FS +  LR H+ A H  + P+ C++  C +RFA K    NH    H
Sbjct:   31 GKKYSRPSLLEQHLRTHSN--ERPFVCDYTGCSKAFYRKSHLKIHKRCHTNVKPFSCH-YDGCD--AQFYTQQHLERHIEVHRK---PKPYACTWEGCDECFSKHQQLRSHISACHTHLLPYPCTYQDCELRFATKQKLQNHVNRAH 169          
BLAST of EY702098 vs. ExPASy Swiss-Prot
Match: TF3A_RAT (Transcription factor IIIA OS=Rattus norvegicus GN=Gtf3a PE=2 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 9.343e-12
Identity = 45/139 (32.37%), Postives = 69/139 (49.64%), Query Frame = 2
Query:   11 GKVFKYASKLRQHEDSHVNLDSVEAFCSEPGCMKYFTNKQCLEA--HIRSCH-QYIPCEICGSM-QLKKNIKRHVRTHEA-RDLSERIKCQFKGCLLSFSTNSNLRQHVKAVHYEIKPFACSFFGCGMRFAFKHVRDNH 412
            GK F   S+L++H   H      E +  + GC   F  K   E   H R  H + + C +C  M + K ++K+H++TH   RD+    +C  +GC  +++T  NL+ H+ + H E +PF C   GCG  FA K     H
Sbjct:  168 GKHFASPSRLKRHGKVH------EGYLCQKGCS--FVGKTWTELLKHTREAHKEEVTCTVCQKMFKRKDHLKQHMKTHAPERDV---YRCPREGCARTYTTVFNLQSHILSFHEEKRPFVCEHAGCGKTFAMKQSLMRH 295          
BLAST of EY702098 vs. ExPASy Swiss-Prot
Match: TF3A_MOUSE (Transcription factor IIIA OS=Mus musculus GN=Gtf3a PE=2 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 4.637e-11
Identity = 43/137 (31.39%), Postives = 68/137 (49.64%), Query Frame = 2
Query:   11 GKVFKYASKLRQHEDSHVNLDSVEAFCSEPGCMKYFTNKQCLEAHIRSCHQY-IPCEICGSMQLKKN-IKRHVRTHEA-RDLSERIKCQFKGCLLSFSTNSNLRQHVKAVHYEIKPFACSFFGCGMRFAFKHVRDNH 412
            GK F   S+L++H   H      E +  + GC         L  H+R  H+  I C +C  M  +++ +K+H++TH   RD+    +C  +GC  +++T  NL+ H+ + H E +PF C   GCG  FA K     H
Sbjct:  168 GKHFASPSRLKRHGKVH------EGYLCQKGCSFMGKTWTELLKHMREAHKEDITCNVCQRMFKRRDYLKQHMKTHAPERDV---YRCPRQGCGRTYTTVFNLQSHILSFHEEKRPFVCEHAGCGKTFAMKQSLMRH 295          
The following BLAST results are available for this feature:
BLAST of EY702098 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
TF3A_HUMAN1.104e-1232.85Transcription factor IIIA OS=Homo sapiens GN=GTF3A... [more]
TF3A_SCHPO5.477e-1230.61Transcription factor IIIA OS=Schizosaccharomyces p... [more]
TF3A_RAT9.343e-1232.37Transcription factor IIIA OS=Rattus norvegicus GN=... [more]
TF3A_MOUSE4.637e-1131.39Transcription factor IIIA OS=Mus musculus GN=Gtf3a... [more]
back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (2 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-701-001-A10-CT.F Sweet orange fruit, development stadium (2 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY702098 ID=EY702098|Name=EY702098|organism=Citrus sinensis|type=EST|length=791bp
CCACGCGTCCGGAAAAGTATTCAAATATGCCTCCAAGTTGCGGCAACACG
AGGATTCTCATGTTAATCTAGACTCTGTGGAGGCATTTTGTTCTGAACCT
GGATGTATGAAGTATTTTACGAATAAACAATGCCTAGAGGCCCACATCAG
GTCATGCCACCAATATATTCCATGTGAGATATGTGGGTCCATGCAGTTGA
AAAAGAATATCAAGCGACATGTCCGCACACATGAAGCCAGAGATTTATCT
GAGAGAATTAAATGCCAATTCAAGGGCTGCCTCCTCTCATTCTCAACTAA
CTCAAACCTCCGGCAGCATGTGAAAGCTGTGCACTATGAAATCAAGCCTT
TTGCCTGTAGCTTTTTTGGTTGTGGCATGAGATTTGCCTTCAAGCATGTG
AGAGATAACCATGAGAAATCTGGGCACCATGTTTATTCTTCTGGGGATTT
TGTAGAGTCGGATGAGCGGTTCAGGTCAAGGGAGAGGGGTGGGCGAAAGA
GGAAATGTCCAACCGTGGAAATGCTGATACGAAAGAGGGTTTCGCTGCCG
AGTCCCACCCAATCTTGTAATCTTTACGAAGATTGATGATACTCCTGATT
GACCTAGGTTTGCAGTATATAGGTACTGCCATTAGATTTCCTCATTGAAA
TTTTGCAGTCACATCCGTCTACTCCATTTACACTGTATGTACCTACTTCA
AAGACTATTAAAGTATTAACATATAATCTATGTATAGTTGAAAAATGAAA
TATAAGCTGCTTCTTATCTCTTGTAAAAAAAAAAAAAAGGG
back to top