EY702096

Overview
NameEY702096
Unique NameEY702096
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length880
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY702096 vs. ExPASy Swiss-Prot
Match: HSF30_SOLPE (Heat shock factor protein HSF30 OS=Solanum peruvianum GN=HSF30 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 8.333e-30
Identity = 66/111 (59.46%), Postives = 80/111 (72.07%), Query Frame = 2
Query:  338 PLEGMHDAGQPPLLTKTYEMIDDLSTEAIVSWSITHNSCCVRDSHQISTTLHTK*C*HSN*STFIRQLNTYGSIKVDPDTCEFADEG*LARQTLLLITIQRTRHVAPSMQQ 670
            P+EG+HD G PP L+KTYEM++D ST+ ++SWS T NS  V DSH+ STTL  +   HSN S+FIRQLNTYG  KVDPD  EFA+EG L  Q  LL TI+R R+V  SM Q
Sbjct:   20 PMEGLHDVGPPPFLSKTYEMVEDSSTDQVISWSTTRNSFIVWDSHKFSTTLLPRFFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRRNVGQSMNQ 130          

HSP 2 Score: 23.0978 bits (48), Expect = 8.333e-30
Identity = 10/25 (40.00%), Postives = 15/25 (60.00%), Query Frame = 3
Query:  666 NRQRR*ACIVERRYGLDREIETFRR 740
            N+Q   ACI    YG++ E+E  +R
Sbjct:  129 NQQGSGACIEIGYYGMEEELERLKR 153          
BLAST of EY702096 vs. ExPASy Swiss-Prot
Match: HSFA2_ARATH (Heat stress transcription factor A-2 OS=Arabidopsis thaliana GN=HSFA2 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 3.181e-25
Identity = 59/105 (56.19%), Postives = 76/105 (72.38%), Query Frame = 2
Query:  338 PLEGMHDAGQPPLLTKTYEMIDDLSTEAIVSWSITHNSCCVRDSHQISTTLHTK*C*HSN*STFIRQLNTYGSIKVDPDTCEFADEG*LARQTLLLITIQRTRHV 652
            P+EG+++ G PP LTKTYEM++D +T+ +VSWS   NS  V DSH+ STTL  +   HSN S+FIRQLNTYG  K+DPD  EFA+EG LA Q  LL  I+R R++
Sbjct:   33 PMEGLNETGPPPFLTKTYEMVEDPATDTVVSWSNGRNSFVVWDSHKFSTTLLPRYFKHSNFSSFIRQLNTYGFRKIDPDRWEFANEGFLAGQKHLLKNIKRRRNM 137          

HSP 2 Score: 21.557 bits (44), Expect = 3.181e-25
Identity = 7/19 (36.84%), Postives = 12/19 (63.16%), Query Frame = 3
Query:  684 ACIVERRYGLDREIETFRR 740
            +C+   +YG D E+E  +R
Sbjct:  150 SCVEVGQYGFDGEVERLKR 168          
BLAST of EY702096 vs. ExPASy Swiss-Prot
Match: HFA2B_ORYSJ (Heat stress transcription factor A-2b OS=Oryza sativa subsp. japonica GN=HSFA2B PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.553e-24
Identity = 60/113 (53.10%), Postives = 74/113 (65.49%), Query Frame = 2
Query:  338 PLEGMHDAGQPPLLTKTYEMIDDLSTEAIVSWSITHNSCCVRDSHQISTTLHTK*C*HSN*STFIRQLNTYGSIKVDPDTCEFADEG*LARQTLLLITIQRTR---HVAPSMQ 667
            P+EG+HDAG PP LTKTY+M+DD  T+A VSWS T NS  V D H  +T L  +   H+N S+F+RQLNTYG  KVDPD  EFA+E  L  Q  LL  I+R +   H A + Q
Sbjct:   41 PMEGLHDAGPPPFLTKTYDMVDDAGTDAAVSWSATSNSFVVWDPHAFATVLLPRFFKHNNFSSFVRQLNTYGFRKVDPDRWEFANENFLRGQRHLLKNIKRRKPPSHTASNQQ 153          
BLAST of EY702096 vs. ExPASy Swiss-Prot
Match: HFA2E_ORYSJ (Heat stress transcription factor A-2e OS=Oryza sativa subsp. japonica GN=HSFA2E PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 6.289e-23
Identity = 57/112 (50.89%), Postives = 76/112 (67.86%), Query Frame = 2
Query:  338 PLEGMHDAGQPPLLTKTYEMIDDLSTEAIVSWSITHNSCCVRDSHQISTTLHTK*C*HSN*STFIRQLNTYGSIKVDPDTCEFADEG*LARQTLLLITIQRTR--HVAPSMQ 667
            P++G+ D G PP LTKTY+M+DD +T+A+VSWS T+NS  V D H     L  +   H+N S+F+RQLNTYG  KVDPD  EFA+EG L  Q  LL +I+R +  + +PS Q
Sbjct:   27 PMDGLADGGPPPFLTKTYDMVDDPTTDAVVSWSATNNSFVVWDPHLFGNVLLPRYFKHNNFSSFVRQLNTYGFRKVDPDKWEFANEGFLRGQKHLLKSIKRRKPPNSSPSQQ 138          
BLAST of EY702096 vs. ExPASy Swiss-Prot
Match: HFA2C_ORYSJ (Heat stress transcription factor A-2c OS=Oryza sativa subsp. japonica GN=HSFA2C PE=2 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 1.830e-22
Identity = 56/115 (48.70%), Postives = 76/115 (66.09%), Query Frame = 2
Query:  338 PLEGMHDAGQPPLLTKTYEMIDDLSTEAIVSWSITHNSCCVRDSHQISTTLHTK*C*HSN*STFIRQLNTYGSIKVDPDTCEFADEG*LARQTLLLITIQRTR---HVAPSMQQA 673
            P+EG+H+ G PP LTKTY++++D +T+ +VSWS   NS  V D H  +  L  +   H+N S+F+RQLNTYG  KVDPD  EFA+EG L  Q  LL TI+R +   +  PS QQ+
Sbjct:   31 PMEGLHEVGPPPFLTKTYDLVEDPATDGVVSWSRAGNSFVVWDPHVFADLLLPRLFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQRHLLKTIKRRKPPSNAPPSQQQS 145          
BLAST of EY702096 vs. ExPASy Swiss-Prot
Match: HFA6B_ARATH (Heat stress transcription factor A-6b OS=Arabidopsis thaliana GN=HSFA6b PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.451e-21
Identity = 56/113 (49.56%), Postives = 75/113 (66.37%), Query Frame = 2
Query:  338 PLEGMHDAGQPPLLTKTYEMIDDLSTEAIVSWSITHNSCCVRDSHQISTTLHTK*C*HSN*STFIRQLNTYGSIKVDPDTCEFADEG*LARQTLLLITIQR--TRHVAPSMQQ 670
            PLEG+H++G PP LTKTY++++D  T  +VSWS ++NS  V D    S TL  +   H+N S+F+RQLNTYG  KV+PD  EFA+EG L  Q  LL  I+R  T + +  MQQ
Sbjct:   50 PLEGLHESGPPPFLTKTYDLVEDSRTNHVVSWSKSNNSFIVWDPQAFSVTLLPRFFKHNNFSSFVRQLNTYGFRKVNPDRWEFANEGFLRGQKHLLKNIRRRKTSNNSNQMQQ 162          
BLAST of EY702096 vs. ExPASy Swiss-Prot
Match: HFA2A_ORYSJ (Heat stress transcription factor A-2a OS=Oryza sativa subsp. japonica GN=HSFA2A PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.311e-20
Identity = 51/106 (48.11%), Postives = 69/106 (65.09%), Query Frame = 2
Query:  329 MQHPLEGMHDAGQPPLLTKTYEMIDDLSTEAIVSWSITHNSCCVRDSHQISTTLHTK*C*HSN*STFIRQLNTYGSIKVDPDTCEFADEG*LARQTLLLITIQRTR 646
            +  P+EG+ +AG PP L KTYE++DD  T+ ++SW    NS  V D++  +  L  +   HSN S+F+RQLNTYG  KVDPD  EFA+EG L  +  LL TI+R R
Sbjct:   39 LPRPMEGLGEAGPPPFLCKTYEVVDDPGTDTVISWGFAGNSFVVWDANAFAAVLLPRYFKHSNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGKKELLKTIKRRR 144          
BLAST of EY702096 vs. ExPASy Swiss-Prot
Match: HFA2D_ORYSJ (Heat stress transcription factor A-2d OS=Oryza sativa subsp. japonica GN=HSFA2D PE=2 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 2.473e-19
Identity = 50/114 (43.86%), Postives = 72/114 (63.16%), Query Frame = 2
Query:  338 PLEGMHDAGQPPLLTKTYEMIDDLSTEAIVSWSITHNSCCVRDSHQISTTLHTK*C*HSN*STFIRQLNTYGSIKVDPDTCEFADEG*LARQTLLLITIQRTRHVA--PSMQQA 673
            P+EG+H+ G PP LTKT++++ D +T+ +VSW    +S  V D H  +     +   H+N S+F+RQLNTYG  K+DPD  EFA++G L  Q  LL  I+R R ++  P  QQA
Sbjct:   26 PMEGLHEVGPPPFLTKTFDLVADPATDGVVSWGRAGSSFVVWDPHVFAAVFLPRFFKHNNFSSFVRQLNTYGFRKIDPDRWEFANDGFLRGQRHLLKMIKRRRPLSYLPGSQQA 139          
BLAST of EY702096 vs. ExPASy Swiss-Prot
Match: HFA7A_ARATH (Heat stress transcription factor A-7a OS=Arabidopsis thaliana GN=HSFA7A PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 7.195e-19
Identity = 52/108 (48.15%), Postives = 67/108 (62.04%), Query Frame = 2
Query:  338 PLEGMHDAGQPPLLTKTYEMIDDLSTEAIVSWSITHNSCCVRDSHQISTTLHTK*C*HSN*STFIRQLNTYGSIKVDPDTCEFADEG*LARQTLLLITIQRTRHVAPS 661
            P+EG+H+   PP LTKT+EM+DD +T+ IVSW+    S  V D H  ST L  +   HSN S+FIRQLNTYG  K++ +  EFA+E  L  Q  LL  I+R     PS
Sbjct:   18 PMEGLHENAPPPFLTKTFEMVDDPNTDHIVSWNRGGTSFVVWDLHSFSTILLPRHFKHSNFSSFIRQLNTYGFRKIEAERWEFANEEFLLGQRQLLKNIKRRNPFTPS 125          
BLAST of EY702096 vs. ExPASy Swiss-Prot
Match: HSF8_SOLPE (Heat shock factor protein HSF8 OS=Solanum peruvianum GN=HSF8 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.337e-18
Identity = 52/101 (51.49%), Postives = 64/101 (63.37%), Query Frame = 2
Query:  368 PPLLTKTYEMIDDLSTEAIVSWSITHNSCCVRDSHQISTTLHTK*C*HSN*STFIRQLNTYGSIKVDPDTCEFADEG*LARQTLLLITIQRTRHVAPSMQQ 670
            PP L KTY+M+DD ST+ IVSWS T+NS  V D  + +  L  K   H+N S+F+RQLNTYG  KVDPD  EFA+EG L  Q  LL +I R +      QQ
Sbjct:   40 PPFLVKTYDMVDDPSTDKIVSWSPTNNSFVVWDPPEFAKDLLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKSISRRKPAHGHAQQ 140          

HSP 2 Score: 22.3274 bits (46), Expect = 1.337e-18
Identity = 7/19 (36.84%), Postives = 13/19 (68.42%), Query Frame = 3
Query:  684 ACIVERRYGLDREIETFRR 740
            AC+   ++GL+ E+E  +R
Sbjct:  163 ACVEVGKFGLEEEVERLKR 181          
The following BLAST results are available for this feature:
BLAST of EY702096 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
HSF30_SOLPE8.333e-3059.46Heat shock factor protein HSF30 OS=Solanum peruvia... [more]
HSFA2_ARATH3.181e-2556.19Heat stress transcription factor A-2 OS=Arabidopsi... [more]
HFA2B_ORYSJ2.553e-2453.10Heat stress transcription factor A-2b OS=Oryza sat... [more]
HFA2E_ORYSJ6.289e-2350.89Heat stress transcription factor A-2e OS=Oryza sat... [more]
HFA2C_ORYSJ1.830e-2248.70Heat stress transcription factor A-2c OS=Oryza sat... [more]
HFA6B_ARATH3.451e-2149.56Heat stress transcription factor A-6b OS=Arabidops... [more]
HFA2A_ORYSJ1.311e-2048.11Heat stress transcription factor A-2a OS=Oryza sat... [more]
HFA2D_ORYSJ2.473e-1943.86Heat stress transcription factor A-2d OS=Oryza sat... [more]
HFA7A_ARATH7.195e-1948.15Heat stress transcription factor A-7a OS=Arabidops... [more]
HSF8_SOLPE1.337e-1851.49Heat shock factor protein HSF8 OS=Solanum peruvian... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (2 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-701-001-A08-CT.F Sweet orange fruit, development stadium (2 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY702096 ID=EY702096|Name=EY702096|organism=Citrus sinensis|type=EST|length=880bp
CCACGCGTCCGGATGATCTCTGTATCTGGAACCTTCTCTTGCGCACCCTC
TGTATAATCCTAAGTTCTCTGCCACAGTTAGACTCTACATCTCAAATCTC
CCCTGGAGATACTTGACGGAAGAATTACAAACGAAGTGCGTAAACATCTC
AAAGTTCGTAGTAGAGCCGTGACTGAAAGCTCGCTTAATTAATAGCTCTC
TGTTTAGAACACTATATTAGCATTAACTATGGAGGGAGTGAGGGGGAATG
AAGAAGAGACAGTGACGTACGGCTGCGACGACAGCTACTGCTGGGTCAAG
GACATCTACTTCGTCGGCTCCCTAGTTTATGCAGCATCCGCTGGAGGGTA
TGCACGATGCGGGCCAGCCTCCGCTTCTGACGAAGACCTACGAAATGATA
GATGATCTATCAACGGAGGCGATCGTTTCCTGGAGCATAACTCACAATAG
CTGCTGTGTGAGGGACTCTCACCAGATCTCTACTACTTTGCATACGAAAT
AGTGCTAGCACAGTAATTGATCTACCTTCATTCGCCAACTGAACACTTAT
GGGTCTATAAAGGTTGATCCTGATACATGCGAATTCGCCGATGAAGGATG
ATTGGCAAGGCAGACTCTTCTACTGATTACGATACAGAGAACGAGACACG
TCGCACCGAGTATGCAACAGGCAACGAAGATAAGCTTGTATTGTCGAGAG
ACGATATGGACTGGATCGTGAGATTGAAACATTTAGACGGTACTATACGT
GTCCATCGGCATAATGGTTATGCTGATGCAACATCAGATGCCACAGGAGC
ACTACTCGNAGAAATGGACGATGGGTTATTACATCTCGACAGGAAGCAGT
GGCCATGATGACATCCCTTGGGCAAGCGTC
back to top