EY702094

Overview
NameEY702094
Unique NameEY702094
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length915
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY702094 vs. ExPASy Swiss-Prot
Match: UBC2_ARATH (Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana GN=UBC2 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.912e-20
Identity = 60/110 (54.55%), Postives = 63/110 (57.27%), Query Frame = 3
Query:  171 MLTPATNRLMMDFHTLRQDPPAGIIGAPQDNSIVLGNAVISLSG*YPMRDGGXXXXXXXXXXXXXXXXXXXXSVSPMLHPYIYADGIICSDILHYLRSPFYDVAAILTSI 500
            M TPA  RLM DF  L+QDPPAGI GAPQDN+I+L NAVI      P  DGG                     VS M HP IYADG IC DIL    SP YDVAAILTSI
Sbjct:    1 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPW-DGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSI 109          
BLAST of EY702094 vs. ExPASy Swiss-Prot
Match: UBC1_ARATH (Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana GN=UBC1 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.912e-20
Identity = 60/110 (54.55%), Postives = 63/110 (57.27%), Query Frame = 3
Query:  171 MLTPATNRLMMDFHTLRQDPPAGIIGAPQDNSIVLGNAVISLSG*YPMRDGGXXXXXXXXXXXXXXXXXXXXSVSPMLHPYIYADGIICSDILHYLRSPFYDVAAILTSI 500
            M TPA  RLM DF  L+QDPPAGI GAPQDN+I+L NAVI      P  DGG                     VS M HP IYADG IC DIL    SP YDVAAILTSI
Sbjct:    1 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPW-DGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSI 109          
BLAST of EY702094 vs. ExPASy Swiss-Prot
Match: UBC2_WHEAT (Ubiquitin-conjugating enzyme E2 2 OS=Triticum aestivum GN=UBC2 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.627e-19
Identity = 66/154 (42.86%), Postives = 72/154 (46.75%), Query Frame = 3
Query:  171 MLTPATNRLMMDFHTLRQDPPAGIIGAPQDNSIVLGNAVISLSG*YPMRDGGXXXXXXXXXXXXXXXXXXXXSVSPMLHPYIYADGIICSDILHYLRSPFYDVAAILTSIHVIAXXXXXXXXXXXXXIPHVYRQQPRIR*DHTGRTVVHTWTAD 632
            M TPA  RLM DF  L+QDPPAGI GAP DN+I L NAVI      P  DGG                     VS M HP IYADG IC DIL    SP YDVAAILTSI  +                 +Y +  R         V  +WTAD
Sbjct:    1 MSTPARKRLMRDFKRLQQDPPAGISGAPHDNNITLWNAVIFGPDDTPW-DGGTFKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSL-LCDPNPNSPANSEAARMYSENKREYNRKVREVVEQSWTAD 152          
BLAST of EY702094 vs. ExPASy Swiss-Prot
Match: UBC2_MEDSA (Ubiquitin-conjugating enzyme E2 2 OS=Medicago sativa GN=UBC2 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.627e-19
Identity = 59/110 (53.64%), Postives = 62/110 (56.36%), Query Frame = 3
Query:  171 MLTPATNRLMMDFHTLRQDPPAGIIGAPQDNSIVLGNAVISLSG*YPMRDGGXXXXXXXXXXXXXXXXXXXXSVSPMLHPYIYADGIICSDILHYLRSPFYDVAAILTSI 500
            M TPA  RLM DF  L+ DPPAGI GAPQDN+I+L NAVI      P  DGG                     VS M HP IYADG IC DIL    SP YDVAAILTSI
Sbjct:    1 MSTPARKRLMRDFKRLQHDPPAGISGAPQDNNIMLWNAVIFGPDDTPW-DGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSI 109          
BLAST of EY702094 vs. ExPASy Swiss-Prot
Match: UBC3_ARATH (Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana GN=UBC3 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.104e-17
Identity = 55/110 (50.00%), Postives = 61/110 (55.45%), Query Frame = 3
Query:  171 MLTPATNRLMMDFHTLRQDPPAGIIGAPQDNSIVLGNAVISLSG*YPMRDGGXXXXXXXXXXXXXXXXXXXXSVSPMLHPYIYADGIICSDILHYLRSPFYDVAAILTSI 500
            M TPA  RLM DF  L++DPP GI GAPQDN+I+  NA+I      P  DGG                     VS M HP IYADG IC DIL    SP YDVAA+LTSI
Sbjct:    1 MTTPAKKRLMWDFKRLQKDPPVGISGAPQDNNIMHWNALIFGPEDTPW-DGGTFKLTLHFTEDYPNKPPIVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAVLTSI 109          
BLAST of EY702094 vs. ExPASy Swiss-Prot
Match: UBE2A_MOUSE (Ubiquitin-conjugating enzyme E2 A OS=Mus musculus GN=Ube2a PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.081e-16
Identity = 51/110 (46.36%), Postives = 61/110 (55.45%), Query Frame = 3
Query:  171 MLTPATNRLMMDFHTLRQDPPAGIIGAPQDNSIVLGNAVISLSG*YPMRDGGXXXXXXXXXXXXXXXXXXXXSVSPMLHPYIYADGIICSDILHYLRSPFYDVAAILTSI 500
            M TPA  RLM DF  L++DPPAG+ GAP +N+I++ NAVI      P  D G                     VS M HP +YADG IC DIL    SP YDV++ILTSI
Sbjct:    1 MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFED-GTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSI 109          
BLAST of EY702094 vs. ExPASy Swiss-Prot
Match: UBE2A_HUMAN (Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens GN=UBE2A PE=2 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 2.081e-16
Identity = 51/110 (46.36%), Postives = 61/110 (55.45%), Query Frame = 3
Query:  171 MLTPATNRLMMDFHTLRQDPPAGIIGAPQDNSIVLGNAVISLSG*YPMRDGGXXXXXXXXXXXXXXXXXXXXSVSPMLHPYIYADGIICSDILHYLRSPFYDVAAILTSI 500
            M TPA  RLM DF  L++DPPAG+ GAP +N+I++ NAVI      P  D G                     VS M HP +YADG IC DIL    SP YDV++ILTSI
Sbjct:    1 MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFED-GTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSI 109          
BLAST of EY702094 vs. ExPASy Swiss-Prot
Match: UBCD6_DROME (Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=UbcD6 PE=2 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 4.637e-16
Identity = 51/110 (46.36%), Postives = 60/110 (54.55%), Query Frame = 3
Query:  171 MLTPATNRLMMDFHTLRQDPPAGIIGAPQDNSIVLGNAVISLSG*YPMRDGGXXXXXXXXXXXXXXXXXXXXSVSPMLHPYIYADGIICSDILHYLRSPFYDVAAILTSI 500
            M TPA  RLM DF  L++DPP G+ GAP DN+I++ NAVI      P  D G                     VS + HP +YADG IC DIL    SP YDV+AILTSI
Sbjct:    1 MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFED-GTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSI 109          
BLAST of EY702094 vs. ExPASy Swiss-Prot
Match: UBE2B_RAT (Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus GN=Ube2b PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 3.005e-15
Identity = 49/110 (44.55%), Postives = 59/110 (53.64%), Query Frame = 3
Query:  171 MLTPATNRLMMDFHTLRQDPPAGIIGAPQDNSIVLGNAVISLSG*YPMRDGGXXXXXXXXXXXXXXXXXXXXSVSPMLHPYIYADGIICSDILHYLRSPFYDVAAILTSI 500
            M TPA  RLM DF  L++DPP G+ GAP +N+I+  NAVI      P  D G                     +S M HP +YADG IC DIL    SP YDV++ILTSI
Sbjct:    1 MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFED-GTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSI 109          
BLAST of EY702094 vs. ExPASy Swiss-Prot
Match: UBE2B_RABIT (Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus cuniculus GN=UBE2B PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 3.005e-15
Identity = 49/110 (44.55%), Postives = 59/110 (53.64%), Query Frame = 3
Query:  171 MLTPATNRLMMDFHTLRQDPPAGIIGAPQDNSIVLGNAVISLSG*YPMRDGGXXXXXXXXXXXXXXXXXXXXSVSPMLHPYIYADGIICSDILHYLRSPFYDVAAILTSI 500
            M TPA  RLM DF  L++DPP G+ GAP +N+I+  NAVI      P  D G                     +S M HP +YADG IC DIL    SP YDV++ILTSI
Sbjct:    1 MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFED-GTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSI 109          
The following BLAST results are available for this feature:
BLAST of EY702094 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
UBC2_ARATH6.912e-2054.55Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis t... [more]
UBC1_ARATH6.912e-2054.55Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis t... [more]
UBC2_WHEAT2.627e-1942.86Ubiquitin-conjugating enzyme E2 2 OS=Triticum aest... [more]
UBC2_MEDSA2.627e-1953.64Ubiquitin-conjugating enzyme E2 2 OS=Medicago sati... [more]
UBC3_ARATH1.104e-1750.00Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis t... [more]
UBE2A_MOUSE2.081e-1646.36Ubiquitin-conjugating enzyme E2 A OS=Mus musculus ... [more]
UBE2A_HUMAN2.081e-1646.36Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens ... [more]
UBCD6_DROME4.637e-1646.36Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophi... [more]
UBE2B_RAT3.005e-1544.55Ubiquitin-conjugating enzyme E2 B OS=Rattus norveg... [more]
UBE2B_RABIT3.005e-1544.55Ubiquitin-conjugating enzyme E2 B OS=Oryctolagus c... [more]

Pages

back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (2 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-701-001-A04-CT.F Sweet orange fruit, development stadium (2 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY702094 ID=EY702094|Name=EY702094|organism=Citrus sinensis|type=EST|length=915bp
CCACGCGTCCGGAACTCTCTCTCACTTGTATCTCTGATCCATTGACTACC
ATGGAATTCTTTCTCTGATACCGCCCGCTTTTCGATTGTTTCCCTAGAAA
TTCTCTCTGCCATTCTGATGCTTTTACTGCCATCGACGCTACTTGCCGCG
TCAGCTCTTAAGCCGCGAGAATGCTCACTCCTGCAACGAACAGATTGATG
ATGGATTTTCATACGTTACGACAAGATCCTCCGGCTGGCATTATTGGTGC
TCCTCAAGACAACAGTATTGTGCTTGGGAATGCTGTCATATCTCTGTCTG
GATGATACCCCATGCGTGATGGAGGCACTTCTACATTGACTCTTACGGTC
ACATAGGATTATCCTGATACGACACCGACGGTGACCTCTGTCTCTCCAAT
GCTACATCCCTATATTTATGCAGATGGAATCATTTGCTCGGACATTCTAC
ATTATCTCAGGAGTCCATTTTACGATGTAGCAGCAATACTCACGTCGATT
CATGTCATTGCTCTTTGACGCAGATCCAGACTCTCCTGTAGATTCCGACG
CATTCCGCATGTGTACCGACAACAACCGCGAATACGATAGGACCATACTG
GTAGAACTGTTGTTCATACTTGGACTGCTGACTAATGGCAACTCTGTAGG
ATCGCAAGGAACTTCGAATTCTGCCGATGGCTTGGTTCTGACTACCCTGA
AGAGTCCAAGGCCCGGGGGGTGACCTCGTGCATGTTTTTCGTGGGCTCCG
CCTTTGATGATGGATGCTCGCCTCCTATGGTAGTTCTCTCCTGGGGGACA
TTGAGCTCAATCGGAATTTTTCATGGTATTTACTCAGCTTGGGCCTGGCT
GAACTATATGAAGAACTATCGCGTTGGGACAAAAAAAAAAAAAAAAAAGG
CTTTTTTCAACTGTA
back to top