DR406106

Overview
NameDR406106
Unique NameDR406106
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length678
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6306 contig Csv1_Contig6306:1..678. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR406106 vs. ExPASy Swiss-Prot
Match: GALE3_ARATH (UDP-glucose 4-epimerase 3 OS=Arabidopsis thaliana GN=At4g23920 PE=2 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 6.551e-74
Identity = 130/173 (75.14%), Postives = 155/173 (89.60%), Query Frame = 3
Query:  159 MAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSE 677
            MAK++LVTGGAGYIGSHTVLQLL GGY  VVVDN DN+S  ++ +VK+LAG  G+ ++FH++DLRD+ ALE +F++TKF AVIHFAGL+AVGESV+KPLLY++NN++GT+TLLEVMA +GCKNLVFSSSATVYGWPK VPCTEE P+ A NPYGRTKLFIEEICRDVHRSDSE
Sbjct:    1 MAKSVLVTGGAGYIGSHTVLQLLEGGYSAVVVDNYDNSSAASLQRVKKLAGENGNRLSFHQVDLRDRPALEKIFSETKFDAVIHFAGLKAVGESVEKPLLYYNNNIVGTVTLLEVMAQYGCKNLVFSSSATVYGWPKEVPCTEESPISATNPYGRTKLFIEEICRDVHRSDSE 173          
BLAST of DR406106 vs. ExPASy Swiss-Prot
Match: GALE2_ARATH (UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=At4g10960 PE=2 SV=3)

HSP 1 Score: 276.559 bits (706), Expect = 8.556e-74
Identity = 130/173 (75.14%), Postives = 157/173 (90.75%), Query Frame = 3
Query:  159 MAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSE 677
            MA+N+LV+GGAGYIGSHTVLQLLLGGY  VVVDNLDN+S +++ +VK+LA   G+ ++FH++DLRD++ALE +F++TKF AVIHFAGL+AVGESV+KPLLY++NNL+GTITLLEVMA HGCKNLVFSSSATVYG PK VPCTEEFP+ A+NPYGRTKLFIEEICRDV+ SD E
Sbjct:    2 MARNVLVSGGAGYIGSHTVLQLLLGGYSVVVVDNLDNSSAVSLQRVKKLAAEHGERLSFHQVDLRDRSALEKIFSETKFDAVIHFAGLKAVGESVEKPLLYYNNNLVGTITLLEVMAQHGCKNLVFSSSATVYGSPKEVPCTEEFPISALNPYGRTKLFIEEICRDVYGSDPE 174          
BLAST of DR406106 vs. ExPASy Swiss-Prot
Match: GALE2_CYATE (UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetragonoloba PE=2 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 5.546e-73
Identity = 132/172 (76.74%), Postives = 151/172 (87.79%), Query Frame = 3
Query:  162 AKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSE 677
            ++ +LVTGGAGYIGSHTVLQLLLGG+K VVVDNLDN+SE A+ +VKELAG    N++FHKLDLRD+ ALE +F+ TKF +VIHFAGL+AVGESVQKPLLY+DNNLIGTI L EVMAAHGCK LVFSSSATVYG PK VPCTEEFPL A NPYGRTKL IEEICRD++R++ E
Sbjct:    3 SQTVLVTGGAGYIGSHTVLQLLLGGFKAVVVDNLDNSSETAIHRVKELAGKFAGNLSFHKLDLRDRDALEKIFSSTKFDSVIHFAGLKAVGESVQKPLLYYDNNLIGTIVLFEVMAAHGCKKLVFSSSATVYGLPKEVPCTEEFPLSAANPYGRTKLIIEEICRDIYRAEQE 174          
BLAST of DR406106 vs. ExPASy Swiss-Prot
Match: GALE1_PEA (UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 8.895e-55
Identity = 104/173 (60.12%), Postives = 133/173 (76.88%), Query Frame = 3
Query:  162 AKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAG-NQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSE 677
            ++ ILVTG AG+IG+HTV+QLL  G+   ++DN DN+   AV +V+E+ G N   N+ F   DLR+K  LE LF+K+KF AVIHFAGL+AVGESV+ P  YFDNNL+GTI L EVMA H CK +VFSSSATVYG P+ +PC E+F L+AMNPYGRTKLF+EEI RD+ +++ E
Sbjct:    5 SQKILVTGSAGFIGTHTVVQLLNNGFNVSIIDNFDNSVMEAVERVREVVGSNLSQNLEFTLGDLRNKDDLEKLFSKSKFDAVIHFAGLKAVGESVENPRRYFDNNLVGTINLYEVMAKHNCKKMVFSSSATVYGQPEKIPCVEDFKLQAMNPYGRTKLFLEEIARDIQKAEPE 177          
BLAST of DR406106 vs. ExPASy Swiss-Prot
Match: GALE1_ARATH (UDP-glucose 4-epimerase 1 OS=Arabidopsis thaliana GN=At1g12780 PE=1 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 5.766e-54
Identity = 103/175 (58.86%), Postives = 135/175 (77.14%), Query Frame = 3
Query:  156 SMAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAG-NQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSE 677
            S+ +NILVTGGAG+IG+HTV+QLL  G+K  ++DN DN+   AV +V+EL G +    + F+  DLR+K  +E LF+K +F AVIHFAGL+AVGESV+ P  YFDNNL+GTI L E MA + CK +VFSSSATVYG P+ +PC E+F L+AMNPYGRTKLF+EEI RD+ +++ E
Sbjct:    4 SVEQNILVTGGAGFIGTHTVVQLLKDGFKVSIIDNFDNSVIEAVDRVRELVGPDLSKKLDFNLGDLRNKGDIEKLFSKQRFDAVIHFAGLKAVGESVENPRRYFDNNLVGTINLYETMAKYNCKMMVFSSSATVYGQPEKIPCMEDFELKAMNPYGRTKLFLEEIARDIQKAEPE 178          
BLAST of DR406106 vs. ExPASy Swiss-Prot
Match: GALE_BACSU (UDP-glucose 4-epimerase OS=Bacillus subtilis GN=galE PE=3 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 5.584e-49
Identity = 97/169 (57.40%), Postives = 128/169 (75.74%), Query Frame = 3
Query:  171 ILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSE 677
            ILVTGGAGYIGSHT ++LL  GY+ VV+DNL N+S  A+ +VKE+ G    ++TF++ DL D+ A++++FA+ +  AVIHFAGL+AVGESV  PL Y+ NNL GT  L E M  +G K +VFSSSATVYG P+  P TE+FPL A NPYG+TKL +E+I RD+H +D+E
Sbjct:    3 ILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGK---DLTFYEADLLDREAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIVFSSSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNE 168          
BLAST of DR406106 vs. ExPASy Swiss-Prot
Match: GALE1_CYATE (UDP-glucose 4-epimerase GEPI42 OS=Cyamopsis tetragonoloba PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.122e-48
Identity = 99/181 (54.70%), Postives = 128/181 (70.72%), Query Frame = 3
Query:  138 LVSPLDSMAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQ-GDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSE 677
            +VS   +  + ILVTGGAG+IGSHTV+QLL  G+   ++DNL N+   AV +V+ L G     N+ FH  DLR+   L+ LF+KTKF AVIHFAGL+ VGESV  P  Y+DNNL+ TI L +VM+   CK LV SSSATVYG P  +PC E+  L AMNPYGR+KLF+EE+ RD+ R+++E
Sbjct:    1 MVSSRMASGETILVTGGAGFIGSHTVVQLLKQGFHVSIIDNLYNSVIDAVHRVRLLVGPLLSSNLHFHHGDLRNIHDLDILFSKTKFDAVIHFAGLKGVGESVLNPSNYYDNNLVATINLFQVMSKFNCKKLVISSSATVYGQPDQIPCVEDSNLHAMNPYGRSKLFVEEVARDIQRAEAE 181          
BLAST of DR406106 vs. ExPASy Swiss-Prot
Match: GALE_DICDI (UDP-glucose 4-epimerase OS=Dictyostelium discoideum GN=galE PE=1 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.594e-46
Identity = 94/179 (52.51%), Postives = 127/179 (70.95%), Query Frame = 3
Query:  141 VSPLDSMAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASEIAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPLEAMNPYGRTKLFIEEICRDVHRSDSE 677
            + P+D     I+VTGGAGYIGSHTV++L+  GY  V+VDNL N+S  A+ +V+ + G +   + FH +D+ ++ AL+ +F      +VIHFAGL+AVGES + PL Y++NN+ GT+TLL +M  H  K LVFSSSATVYG P  VP TE+FPL A NPYGRTKL++E I +D+  SD E
Sbjct:    1 MEPIDD---RIMVTGGAGYIGSHTVIELIEAGYTPVIVDNLSNSSLEAIKRVESITGKE---IEFHHVDIMNEKALDEIFETGNIRSVIHFAGLKAVGESNKLPLKYYNNNIAGTLTLLNLMDKHRVKKLVFSSSATVYGDPHTVPITEDFPLSATNPYGRTKLYVEGILQDLCASDPE 173          
BLAST of DR406106 vs. ExPASy Swiss-Prot
Match: GALE_MOUSE (UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.681e-45
Identity = 100/177 (56.50%), Postives = 126/177 (71.19%), Query Frame = 3
Query:  165 KNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASE------IAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSDS 674
            + +LVTGGAGYIGSHTVL+LL  GY  VV+DN  NA         ++ +V+EL G    ++ F ++D+ D+AAL+ LF K  F AVIHFAGL+AVGESVQKPL Y+  NL GTI LLE+M AHG KNLVFSSSATVYG P+ +P  E  P     NPYG++K FIEE+ RD+ R+D+
Sbjct:    2 EKVLVTGGAGYIGSHTVLELLEAGYSPVVIDNFHNAIRGEDSMPESLRRVQELTGR---SVEFEEMDILDQAALQHLFKKHSFKAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMRAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCRADT 175          
BLAST of DR406106 vs. ExPASy Swiss-Prot
Match: GALE_PONAB (UDP-glucose 4-epimerase OS=Pongo abelii GN=GALE PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 2.868e-45
Identity = 100/178 (56.18%), Postives = 126/178 (70.79%), Query Frame = 3
Query:  159 MAKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNASE------IAVAKVKELAGNQGDNMTFHKLDLRDKAALEALFAKTKFGAVIHFAGLEAVGESVQKPLLYFDNNLIGTITLLEVMAAHGCKNLVFSSSATVYGWPKVVPCTEEFPL-EAMNPYGRTKLFIEEICRDVHRSD 671
            MA+ +LVTGGAGYIGSHTVL+LL  GY  VV+DN  NA         ++ +V+EL G    ++ F ++D+ D+ AL+ LF K  F AVIHFAGL+AVGESVQKPL Y+  NL GTI LLE+M AHG KNLVFSSSATVYG P+ +P  E  P     NPYG++K FIEE+ RD+ ++D
Sbjct:    1 MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGR---SVEFEEMDILDQGALQRLFKKHSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQAD 175          
The following BLAST results are available for this feature:
BLAST of DR406106 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
GALE3_ARATH6.551e-7475.14UDP-glucose 4-epimerase 3 OS=Arabidopsis thaliana ... [more]
GALE2_ARATH8.556e-7475.14UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana ... [more]
GALE2_CYATE5.546e-7376.74UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetrag... [more]
GALE1_PEA8.895e-5560.12UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE P... [more]
GALE1_ARATH5.766e-5458.86UDP-glucose 4-epimerase 1 OS=Arabidopsis thaliana ... [more]
GALE_BACSU5.584e-4957.40UDP-glucose 4-epimerase OS=Bacillus subtilis GN=ga... [more]
GALE1_CYATE2.122e-4854.70UDP-glucose 4-epimerase GEPI42 OS=Cyamopsis tetrag... [more]
GALE_DICDI2.594e-4652.51UDP-glucose 4-epimerase OS=Dictyostelium discoideu... [more]
GALE_MOUSE1.681e-4556.50UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE... [more]
GALE_PONAB2.868e-4556.18UDP-glucose 4-epimerase OS=Pongo abelii GN=GALE PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248L22 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248L22 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR406106 ID=DR406106|Name=DR406106|organism=Citrus sinensis|type=EST|length=678bp
GGGGGTCAGTTTCATTTTTTTCTTTTCCTTTAAATTTCTCTGAGCGAGGC
CAAGCCCAAGTCTCATCACTTCCTTCGTAATTCCCCCGTTTCTTCAAATT
TTCGTGTACTTTGTGCCCTTTTTTTTGGTTCTTCTGATTGGTCTCTCCGT
TAGACTCCATGGCTAAGAACATTTTGGTGACCGGTGGCGCCGGTTACATT
GGAAGCCACACCGTGCTTCAGTTGCTGTTAGGCGGTTACAAAACTGTCGT
CGTCGACAATCTCGATAATGCCTCGGAAATCGCCGTCGCAAAAGTCAAAG
AACTCGCTGGCAATCAAGGCGACAACATGACCTTTCATAAGTTGGATCTC
CGGGACAAAGCAGCGCTGGAAGCATTGTTTGCCAAAACAAAGTTCGGTGC
TGTCATCCATTTTGCTGGACTGGAAGCAGTTGGTGAAAGTGTGCAGAAAC
CATTGCTGTATTTTGACAACAATCTTATTGGAACCATAACTCTCTTGGAA
GTTATGGCAGCACATGGCTGCAAAAATCTGGTCTTTTCATCATCAGCTAC
TGTTTATGGCTGGCCAAAGGTGGTTCCGTGTACAGAAGAGTTCCCGTTAG
AGGCAATGAACCCTTATGGACGTACCAAGCTTTTCATTGAAGAGATTTGC
CGTGATGTCCACCGCTCAGACTCTGAAA
back to top