DR406105

Overview
NameDR406105
Unique NameDR406105
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length554
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DR406105 vs. ExPASy Swiss-Prot
Match: PSD7_ARATH (Probable 26S proteasome non-ATPase regulatory subunit 7 OS=Arabidopsis thaliana GN=RPN8 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 7.291e-45
Identity = 93/116 (80.17%), Postives = 97/116 (83.62%), Query Frame = 2
Query:    5 STLANEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQDVFNLLPNLNVAELIKAFSVKTNDMMLVIYLSSLIRSVIALHXXXXXXXXXXEHEKTEDAKPTAVPTAS 352
            STLA EVT KLTALKGLDARLREIR YLDLVI+ KLPLNHEILYHLQDVFNLLPNLNV EL+KAFSVKTNDMMLVIYLSSLIRSVIALH          EHEK ED+KP A+P  S
Sbjct:  193 STLATEVTAKLTALKGLDARLREIRSYLDLVIEGKLPLNHEILYHLQDVFNLLPNLNVNELVKAFSVKTNDMMLVIYLSSLIRSVIALHNLINNKLLNKEHEKAEDSKPVAIPATS 308          
BLAST of DR406105 vs. ExPASy Swiss-Prot
Match: PSD7_BOVIN (26S proteasome non-ATPase regulatory subunit 7 OS=Bos taurus GN=PSMD7 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 4.913e-25
Identity = 54/104 (51.92%), Postives = 77/104 (74.04%), Query Frame = 2
Query:    8 TLANEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQDVFNLLPNLNVAELIKAFSVKTNDMMLVIYLSSLIRSVIALHXXXXXXXXXXEHEKTE 319
            TL+  +T ++  LKGL+++L +IRGYL+ V   KLP+NH+I+Y LQDVFNLLP++++ E +KAF +KTND M+V+YL+SLIRSV+ALH          + EK E
Sbjct:  186 TLSQRITNQVHGLKGLNSKLLDIRGYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKE 289          
BLAST of DR406105 vs. ExPASy Swiss-Prot
Match: PSD7_HUMAN (26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens GN=PSMD7 PE=1 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 2.439e-24
Identity = 53/104 (50.96%), Postives = 76/104 (73.08%), Query Frame = 2
Query:    8 TLANEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQDVFNLLPNLNVAELIKAFSVKTNDMMLVIYLSSLIRSVIALHXXXXXXXXXXEHEKTE 319
            TL+  +T ++  LKGL+++L +IR YL+ V   KLP+NH+I+Y LQDVFNLLP++++ E +KAF +KTND M+V+YL+SLIRSV+ALH          + EK E
Sbjct:  186 TLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKE 289          
BLAST of DR406105 vs. ExPASy Swiss-Prot
Match: PSD7_MOUSE (26S proteasome non-ATPase regulatory subunit 7 OS=Mus musculus GN=Psmd7 PE=1 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 3.185e-24
Identity = 53/104 (50.96%), Postives = 75/104 (72.12%), Query Frame = 2
Query:    8 TLANEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQDVFNLLPNLNVAELIKAFSVKTNDMMLVIYLSSLIRSVIALHXXXXXXXXXXEHEKTE 319
            TL+  +T ++  LKGL+++L +IR YL+ V   KLP+NH+I+Y LQDVFNLLP+ ++ E +KAF +KTND M+V+YL+SLIRSV+ALH          + EK E
Sbjct:  186 TLSQRITNQVHGLKGLNSKLLDIRSYLEKVASGKLPINHQIIYQLQDVFNLLPDASLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKE 289          
BLAST of DR406105 vs. ExPASy Swiss-Prot
Match: PSD7_DROME (26S proteasome non-ATPase regulatory subunit 7 OS=Drosophila melanogaster GN=Mov34 PE=1 SV=6)

HSP 1 Score: 102.064 bits (253), Expect = 1.932e-21
Identity = 46/88 (52.27%), Postives = 68/88 (77.27%), Query Frame = 2
Query:    8 TLANEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQDVFNLLPNLNVAELIKAFSVKTNDMMLVIYLSSLIRSVIALH 271
            +L+ ++T +L  LKGL+A+LR+I+ YL  V D K+P+NH+I+Y LQD+FNLLP++   +      VKTND MLV+YL+S++RS+IALH
Sbjct:  189 SLSQKITNQLMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTNDQMLVVYLASMVRSIIALH 276          
BLAST of DR406105 vs. ExPASy Swiss-Prot
Match: PSD7_DICDI (26S proteasome non-ATPase regulatory subunit 7 OS=Dictyostelium discoideum GN=psmD7 PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 2.523e-21
Identity = 54/118 (45.76%), Postives = 75/118 (63.56%), Query Frame = 2
Query:    5 STLANEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQDVFNLLPNLNVAELIKAFSVKTNDMMLVIYLSSLIRSVIALHXXXXXXXXXXEHEKTEDAKPTAVPTASSS 358
            S+L  ++T K  +LK L   L+E++ YL LV D  LP NH+I+ ++QD+ NL PNLN  E+ K+F+V+ ND M VIYLSS+IRS+IALH          E EK  D   +  PT ++S
Sbjct:  183 SSLTTQITDKKISLKHLLTNLQEMQHYLKLVCDGTLPPNHQIIGYIQDIINLSPNLNANEISKSFAVQNNDTMSVIYLSSMIRSIIALHNLIINKTANREAEKKADIINSTPPTTATS 300          
BLAST of DR406105 vs. ExPASy Swiss-Prot
Match: RPN8_NEUCR (26S proteasome regulatory subunit rpn-8 OS=Neurospora crassa GN=rpn-8 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 4.759e-20
Identity = 52/120 (43.33%), Postives = 74/120 (61.67%), Query Frame = 2
Query:    8 TLANEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQDVFNLLPNLNV-------------AELIKAFSVKTNDMMLVIYLSSLIRSVIALHXXXXXXXXXXEHEKTEDAK 328
            TL+  +T ++ +L+GL  RLR+I+ YL  V+D +LP+NH IL +LQDVFNLLPNL+              +EL  A S+KTND ++ IYLSSLIR++ A H          + ++  DAK
Sbjct:  194 TLSTRITNQMRSLQGLHHRLRDIQAYLQKVLDGQLPVNHAILGNLQDVFNLLPNLSTPKSGPGATGTNADSELNHAMSIKTNDQLMAIYLSSLIRAITAFHDLIENKIQNRQQQEENDAK 313          
BLAST of DR406105 vs. ExPASy Swiss-Prot
Match: RPN8_SCHPO (26S proteasome regulatory subunit rpn8 OS=Schizosaccharomyces pombe GN=rpn8 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.887e-17
Identity = 51/119 (42.86%), Postives = 71/119 (59.66%), Query Frame = 2
Query:    8 TLANEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQDVFNLLPNLNVAELI----------KAFSVKTNDMMLVIYLSSLIRSVIALHXXXXXXXXXXEHEKTEDAKPT 334
            TLA  VT +  +L+GL  RL EI  YL  V+D +LP+NH IL  LQ VFNLLPN+    ++          +AF+V +ND ++ IY+SS++R+VIALH            E+ +D KPT
Sbjct:  193 TLATRVTQQAQSLQGLGQRLTEIADYLRKVVDGQLPINHAILAELQSVFNLLPNIFSGPVVSEQALESEAQRAFNVNSNDQLMSIYISSIVRAVIALHDLLDSLAASKAMEQ-QDIKPT 310          
BLAST of DR406105 vs. ExPASy Swiss-Prot
Match: RPN8_YEAST (26S proteasome regulatory subunit RPN8 OS=Saccharomyces cerevisiae GN=RPN8 PE=1 SV=3)

HSP 1 Score: 87.0409 bits (214), Expect = 6.432e-17
Identity = 47/102 (46.08%), Postives = 68/102 (66.67%), Query Frame = 2
Query:   11 LANEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQDVFNLLPNLNVAE-----------------LIKAFSVKTNDMMLVIYLSSLIRSVIA 265
            L+  +T +L +LKGL ++L+++  YLD VI+++LP+NH IL  LQDVFNLLPNL   +                 L KA +VKTND ++VIY+S+L+RS+IA
Sbjct:  186 LSIRLTNQLKSLKGLQSKLKDVVEYLDKVINKELPINHTILGKLQDVFNLLPNLGTPDDDEIDVENHDRINISNNLQKALTVKTNDELMVIYISNLVRSIIA 287          
BLAST of DR406105 vs. ExPASy Swiss-Prot
Match: RPN8_CANGA (26S proteasome regulatory subunit RPN8 OS=Candida glabrata GN=RPN8 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.341e-14
Identity = 45/102 (44.12%), Postives = 65/102 (63.73%), Query Frame = 2
Query:   11 LANEVTGKLTALKGLDARLREIRGYLDLVIDEKLPLNHEILYHLQDVFNLLPNLNVAE-----------------LIKAFSVKTNDMMLVIYLSSLIRSVIA 265
            L+  +T +L +LKGL  +L +I  YL+ VI+ +LP+NH IL  LQDVFNLLPNL   E                 L +A +VKTND ++VIY+++L+R++IA
Sbjct:  186 LSIRLTNQLKSLKGLQKKLNDIVIYLNKVINNELPVNHTILGKLQDVFNLLPNLGYNEETDVSATSNDMVTASNNLQRALTVKTNDELMVIYITNLVRAIIA 287          
The following BLAST results are available for this feature:
BLAST of DR406105 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
PSD7_ARATH7.291e-4580.17Probable 26S proteasome non-ATPase regulatory subu... [more]
PSD7_BOVIN4.913e-2551.9226S proteasome non-ATPase regulatory subunit 7 OS=... [more]
PSD7_HUMAN2.439e-2450.9626S proteasome non-ATPase regulatory subunit 7 OS=... [more]
PSD7_MOUSE3.185e-2450.9626S proteasome non-ATPase regulatory subunit 7 OS=... [more]
PSD7_DROME1.932e-2152.2726S proteasome non-ATPase regulatory subunit 7 OS=... [more]
PSD7_DICDI2.523e-2145.7626S proteasome non-ATPase regulatory subunit 7 OS=... [more]
RPN8_NEUCR4.759e-2043.3326S proteasome regulatory subunit rpn-8 OS=Neurosp... [more]
RPN8_SCHPO2.887e-1742.8626S proteasome regulatory subunit rpn8 OS=Schizosa... [more]
RPN8_YEAST6.432e-1746.0826S proteasome regulatory subunit RPN8 OS=Saccharo... [more]
RPN8_CANGA1.341e-1444.1226S proteasome regulatory subunit RPN8 OS=Candida ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248L21 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248L21 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR406105 ID=DR406105|Name=DR406105|organism=Citrus sinensis|type=EST|length=554bp
GGGCAGTACACTTGCAAATGAGGTCACTGGAAAACTTACAGCCCTAAAGG
GTCTGGATGCTCGTTTGCGTGAGATCCGTGGTTACCTTGACCTTGTTATT
GATGAGAAACTTCCGTTGAATCACGAGATACTTTACCATTTACAGGATGT
GTTTAACCTTTTACCGAATCTGAATGTGGCTGAATTAATCAAGGCCTTTT
CAGTAAAAACAAATGATATGATGTTGGTTATATATCTTTCGTCCCTCATC
CGGAGTGTTATTGCACTACATAACTTAATCAATAACAAGATTTTGAACAA
AGAACACGAAAAGACTGAGGACGCAAAGCCAACGGCAGTTCCAACTGCCA
GTTCAAGTTAAAATCAAGTTTGTTGTGCTTTGGGGCTTTCAGCCATTACC
GAACTGGGGCATTTGAAAATGGAAGAGAGGGGTGGGGGTTGGGGGGAGTG
TGTGGTTAGGTGGAGCCAGTTANNNGTCGANNNNNAGAGGTTACATTTGC
CGACAGTTTTCTCCTACTGAGCATCATCAGAGATAACTGTGCTCCAAAAA
GCTT
back to top