DR406103

Overview
NameDR406103
Unique NameDR406103
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length760
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4631 contig Csv1_Contig4631:41..800. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR406103 vs. ExPASy Swiss-Prot
Match: PSB2A_ARATH (Proteasome subunit beta type-2-A OS=Arabidopsis thaliana GN=PBD1 PE=1 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 2.763e-98
Identity = 174/198 (87.88%), Postives = 190/198 (95.96%), Query Frame = 2
Query:   83 MECVFGLVGDGFAILVADTSAVHSILVHKSNEDKIMVLDSHKLIAASGEPGDRVQFTEFIQKNVSLYQFRNGIPLTTAAAANFTRGELATALRKSPYMVNILLAGYDKETGPSLYYIDYIATLHKVDKAAFGYGSYFSLSMMDRHFHSGMSVEEAVDLVDKCILEIRSRLVVAPPNFVIKIVDKDGAREYAWRESVKD 676
            MECVFGLVG+GFAI+ ADTSAVHSIL+HK+NEDKIMVLDSHKL+AASGEPGDRVQFTE++QKNVSLY+FRNGIPLTTAAAANFTRGELATALRK+PY VNIL+AGYD E+G SLYYIDYIATLHKVDK AFGYGSYFSLS MDRH+ S MSVEEA++LVDKCILEIRSRLVVAPPNFVIKIVDKDGAR+YAWR+SVKD
Sbjct:    1 MECVFGLVGNGFAIVAADTSAVHSILLHKNNEDKIMVLDSHKLVAASGEPGDRVQFTEYVQKNVSLYKFRNGIPLTTAAAANFTRGELATALRKNPYSVNILMAGYDDESGASLYYIDYIATLHKVDKGAFGYGSYFSLSTMDRHYRSDMSVEEAIELVDKCILEIRSRLVVAPPNFVIKIVDKDGARDYAWRQSVKD 198          
BLAST of DR406103 vs. ExPASy Swiss-Prot
Match: PSB2B_ARATH (Proteasome subunit beta type-2-B OS=Arabidopsis thaliana GN=PBD2 PE=1 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 9.828e-96
Identity = 170/198 (85.86%), Postives = 184/198 (92.93%), Query Frame = 2
Query:   83 MECVFGLVGDGFAILVADTSAVHSILVHKSNEDKIMVLDSHKLIAASGEPGDRVQFTEFIQKNVSLYQFRNGIPLTTAAAANFTRGELATALRKSPYMVNILLAGYDKETGPSLYYIDYIATLHKVDKAAFGYGSYFSLSMMDRHFHSGMSVEEAVDLVDKCILEIRSRLVVAPPNFVIKIVDKDGAREYAWRESVKD 676
            MECVFGLVG+GFAI+ ADTSAVHSIL+HK+ EDKIM LDSHKL+AASGEPGDRVQFTE++QKNVSLYQFRNGIPL+TAAAANFTRGELATALRK+PY VNIL+AGYDKE G SLYYIDYIATLHKVDK AFGYGSYFSLS MDRH+ S MSVEEA++LVDKCILEIRSRLV+APPNFVIKIVDKDGAREY WR S  D
Sbjct:    1 MECVFGLVGNGFAIVAADTSAVHSILLHKNKEDKIMTLDSHKLVAASGEPGDRVQFTEYVQKNVSLYQFRNGIPLSTAAAANFTRGELATALRKNPYSVNILMAGYDKEAGASLYYIDYIATLHKVDKGAFGYGSYFSLSTMDRHYRSDMSVEEAIELVDKCILEIRSRLVIAPPNFVIKIVDKDGAREYGWRISTAD 198          
BLAST of DR406103 vs. ExPASy Swiss-Prot
Match: PSB2_ORYSJ (Proteasome subunit beta type-2 OS=Oryza sativa subsp. japonica GN=PBD1 PE=2 SV=2)

HSP 1 Score: 308.916 bits (790), Expect = 1.923e-83
Identity = 153/204 (75.00%), Postives = 175/204 (85.78%), Query Frame = 2
Query:   83 MECVFGLVGDGFAILVADTSAVHSILVHKSNEDKIMVLDSHKLIAASGEPGDRVQFTEFIQKNVSLYQFRNGIPLTTAAAANFTRGELATALRKSPYMVNILLAGYDKETGPSLYYIDYIATLHKVDKAAFGYGSYFSLSMMDRHFHSGMSVEEAVDLVDKCILEIRSRLVVAPPNFVIKIVDKDGAREYAWRESVKDTPVSSA 694
            MECV G+VG  FA++ ADTSAV SILVHK++EDK+MVLDSHKL+ ASGEPGDRVQFTEFIQKN+ LYQFRN IPL+TAA ANFTRGELATALRK+PY VN+LLAGYD + G SLYYIDYIAT HK++K AFGYGSYF LS+MD+ +   MSVEEAVDLVDKCI EIR RLVVAP NF+IKIVDK+GAREYA R +  D+P  +A
Sbjct:    1 MECVIGVVGRDFAVVAADTSAVQSILVHKTDEDKVMVLDSHKLMGASGEPGDRVQFTEFIQKNLHLYQFRNNIPLSTAATANFTRGELATALRKNPYYVNVLLAGYDSDVGASLYYIDYIATFHKIEKGAFGYGSYFCLSLMDKLYRPDMSVEEAVDLVDKCIKEIRLRLVVAPQNFIIKIVDKEGAREYA-RRAYTDSPPEAA 203          
BLAST of DR406103 vs. ExPASy Swiss-Prot
Match: PSB2_DICDI (Proteasome subunit beta type-2 OS=Dictyostelium discoideum GN=psmB2 PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 7.897e-45
Identity = 86/191 (45.03%), Postives = 128/191 (67.02%), Query Frame = 2
Query:   83 MECVFGLVGDGFAILVADTSAVHSILVHKSNEDKIMVLDSHKLIAASGEPGDRVQFTEFIQKNVSLYQFRNGIPLTTAAAANFTRGELATALRKSPYMVNILLAGYDKET---GPSLYYIDYIATLHKVDKAAFGYGSYFSLSMMDRHFHSGMSVEEAVDLVDKCILEIRSRLVVAPPNFVIKIVDKDGAR 646
            ME +      G  + +AD+S  HSI+  K +EDKI+ +D HKL+ ++GE GDRVQFTE+I KN+ LY  RN  P++T AAANF R ELAT++R  PY +N++LAGYDKE    G SLYY+DY+ +L K++    GY SYF L ++DRH    +S+E+ ++L+  C  E+++R +V+   + +K V  +G +
Sbjct:    1 METLLAFKVKGGVLCLADSSVNHSIVKMKDDEDKILEIDGHKLLLSAGEAGDRVQFTEYISKNIKLYSLRNSYPMSTPAAANFIRNELATSIRSHPYSINLILAGYDKEVEDGGTSLYYMDYLGSLQKLNFGCHGYASYFLLGLLDRHHKCDLSLEDGINLMHLCTTELKTRFLVS-GKYTLKFVSSEGIK 190          
BLAST of DR406103 vs. ExPASy Swiss-Prot
Match: PSB2_RAT (Proteasome subunit beta type-2 OS=Rattus norvegicus GN=Psmb2 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.333e-43
Identity = 85/187 (45.45%), Postives = 126/187 (67.38%), Query Frame = 2
Query:   83 MECVFGLVGDGFAILVADTSAVHSILVHKSNEDKIMVLDSHKLIAASGEPGDRVQFTEFIQKNVSLYQFRNGIPLTTAAAANFTRGELATALR-KSPYMVNILLAGYDKETGPSLYYIDYIATLHKVDKAAFGYGSYFSLSMMDRHFHSGMSVEEAVDLVDKCILEIRSRLVVAPPNFVIKIVDKDG 640
            ME + G+ G  + ++ +D  A  +I+  K + DK+  +    L+   GE GD VQF E+IQKNV LY+ RNG  L+  AAANFTR  LA  LR ++PY VN+LLAGYD+  GP+LYY+DY+A L K   AA GYG++ +LS++DR++   +S E AV+L+ KC+ E++ R ++  P F ++++DKDG
Sbjct:    1 MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDG 187          
BLAST of DR406103 vs. ExPASy Swiss-Prot
Match: PSB2_MOUSE (Proteasome subunit beta type-2 OS=Mus musculus GN=Psmb2 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.333e-43
Identity = 85/187 (45.45%), Postives = 126/187 (67.38%), Query Frame = 2
Query:   83 MECVFGLVGDGFAILVADTSAVHSILVHKSNEDKIMVLDSHKLIAASGEPGDRVQFTEFIQKNVSLYQFRNGIPLTTAAAANFTRGELATALR-KSPYMVNILLAGYDKETGPSLYYIDYIATLHKVDKAAFGYGSYFSLSMMDRHFHSGMSVEEAVDLVDKCILEIRSRLVVAPPNFVIKIVDKDG 640
            ME + G+ G  + ++ +D  A  +I+  K + DK+  +    L+   GE GD VQF E+IQKNV LY+ RNG  L+  AAANFTR  LA  LR ++PY VN+LLAGYD+  GP+LYY+DY+A L K   AA GYG++ +LS++DR++   +S E AV+L+ KC+ E++ R ++  P F ++++DKDG
Sbjct:    1 MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDG 187          
BLAST of DR406103 vs. ExPASy Swiss-Prot
Match: PSB2_HUMAN (Proteasome subunit beta type-2 OS=Homo sapiens GN=PSMB2 PE=1 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 9.653e-43
Identity = 85/190 (44.74%), Postives = 127/190 (66.84%), Query Frame = 2
Query:   83 MECVFGLVGDGFAILVADTSAVHSILVHKSNEDKIMVLDSHKLIAASGEPGDRVQFTEFIQKNVSLYQFRNGIPLTTAAAANFTRGELATALR-KSPYMVNILLAGYDKETGPSLYYIDYIATLHKVDKAAFGYGSYFSLSMMDRHFHSGMSVEEAVDLVDKCILEIRSRLVVAPPNFVIKIVDKDGARE 649
            ME + G+ G  + ++ +D  A  +I+  K + DK+  +    L+   GE GD VQF E+IQKNV LY+ RNG  L+  AAANFTR  LA  LR ++PY VN+LLAGYD+  GP+LYY+DY+A L K   AA GYG++ +LS++DR++   +S E AV+L+ KC+ E++ R ++  P F ++I+DK+G  +
Sbjct:    1 MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHD 190          
BLAST of DR406103 vs. ExPASy Swiss-Prot
Match: PSB2_BOVIN (Proteasome subunit beta type-2 OS=Bos taurus GN=PSMB2 PE=1 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.809e-42
Identity = 84/190 (44.21%), Postives = 128/190 (67.37%), Query Frame = 2
Query:   83 MECVFGLVGDGFAILVADTSAVHSILVHKSNEDKIMVLDSHKLIAASGEPGDRVQFTEFIQKNVSLYQFRNGIPLTTAAAANFTRGELATALR-KSPYMVNILLAGYDKETGPSLYYIDYIATLHKVDKAAFGYGSYFSLSMMDRHFHSGMSVEEAVDLVDKCILEIRSRLVVAPPNFVIKIVDKDGARE 649
            ME + G+ G  + ++ +D  A  +I+  K + DK+  +    L+   GE GD VQF E+IQKNV LY+ RNG  L+  AAANFTR  LA  LR ++PY VN+LLAGYD+  GP+LYY+DY+A L K   AA GYG++ +LS++DR++   +S E+AV+L+ KC+ E++ R ++  P F ++I+D++G  +
Sbjct:    1 MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADYLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISREKAVELLRKCLEELQKRFILNLPTFSVRIIDRNGIHD 190          
BLAST of DR406103 vs. ExPASy Swiss-Prot
Match: PSB2_NEUCR (Probable proteasome subunit beta type-2 OS=Neurospora crassa GN=15E6.60 PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.442e-38
Identity = 82/188 (43.62%), Postives = 118/188 (62.77%), Query Frame = 2
Query:   83 MECVFGLVGDGFAILVADTSAVHSILVHKSNEDKIMVLDSHKLIAASGEPGDRVQFTEFIQKNVSLYQFRNGIPLTTAAAANFTRGELATALR-KSPYMVNILLAGYDKET-GPSLYYIDYIATLHKVDKAAFGYGSYFSLSMMDRHFHSGMSVEEAVDLVDKCILEIRSRLVVAPPNFVIKIVDKDG 640
            M  + G+ G  F I+ A  +A+    + K+++DK   L+ H L+A SGE GD VQF E+ Q N  LY  RNG  L+ +A ANF RGELAT+LR + PY VN+LL G D  T  PSLY++DY+A+L KV  AA GY  Y+ LS++D+H H  +++ + + L++ C  E++ RL +      +K V KDG
Sbjct:    1 MYVLLGITGKDFTIIAASKAAMRGATILKASDDKTRSLNKHTLMAFSGEAGDTVQFAEYTQANAQLYSMRNGTDLSPSALANFVRGELATSLRSRKPYNVNLLLGGVDPITHKPSLYWLDYLASLAKVPYAAHGYAQYYCLSILDKHHHPDITLHQGIKLLNLCTDELKRRLPIDFKGMTVKAVTKDG 188          
BLAST of DR406103 vs. ExPASy Swiss-Prot
Match: PSB2_SCHPO (Probable proteasome subunit beta type-2 OS=Schizosaccharomyces pombe GN=SPAC31A2.04c PE=2 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.884e-38
Identity = 80/191 (41.88%), Postives = 122/191 (63.87%), Query Frame = 2
Query:   83 MECVFGLVGDGFAILVADTSAVHSILVHKSNEDKIMVLDSHKLIAASGEPGDRVQFTEFIQKNVSLYQFRNGIPLTTAAAANFTRGELATALR-KSPYMVNILLAGYDKETG-PSLYYIDYIATLHKVDKAAFGYGSYFSLSMMDRHFHSGMSVEEAVDLVDKCILEIRSRLVVAPPNFVIKIVDKDGARE 649
            ME +  + G  F +  + +SAV  I V K ++DK  +L+SH L+   GE GD   F E+I  N+SLY  R+ + L+  A A+FTR +LAT+LR + PY VNILLAGY+   G P L+++DY+AT  +V  A  GY S++ LS+ DR++   ++++EAV ++  C  E++ R+ +    F+ K+VDKDG RE
Sbjct:    1 MESLLAVQGQDFVLTASSSSAVRGITVLKPDDDKSQILNSHNLMLYCGEAGDTTNFAEYIAANISLYTLRHNLNLSPEATASFTRKQLATSLRSRKPYQVNILLAGYETNLGKPELFWLDYLATCVRVPYACQGYSSFYCLSIFDRYYKPDLTIDEAVRIMKLCFDELKKRMPIDFKGFICKVVDKDGIRE 191          
The following BLAST results are available for this feature:
BLAST of DR406103 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
PSB2A_ARATH2.763e-9887.88Proteasome subunit beta type-2-A OS=Arabidopsis th... [more]
PSB2B_ARATH9.828e-9685.86Proteasome subunit beta type-2-B OS=Arabidopsis th... [more]
PSB2_ORYSJ1.923e-8375.00Proteasome subunit beta type-2 OS=Oryza sativa sub... [more]
PSB2_DICDI7.897e-4545.03Proteasome subunit beta type-2 OS=Dictyostelium di... [more]
PSB2_RAT4.333e-4345.45Proteasome subunit beta type-2 OS=Rattus norvegicu... [more]
PSB2_MOUSE4.333e-4345.45Proteasome subunit beta type-2 OS=Mus musculus GN=... [more]
PSB2_HUMAN9.653e-4344.74Proteasome subunit beta type-2 OS=Homo sapiens GN=... [more]
PSB2_BOVIN2.809e-4244.21Proteasome subunit beta type-2 OS=Bos taurus GN=PS... [more]
PSB2_NEUCR1.442e-3843.62Probable proteasome subunit beta type-2 OS=Neurosp... [more]
PSB2_SCHPO1.884e-3841.88Probable proteasome subunit beta type-2 OS=Schizos... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248L18 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248L18 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR406103 ID=DR406103|Name=DR406103|organism=Citrus sinensis|type=EST|length=760bp
GGGGATAATCTGTTTAACTCAAAACCCACGCTCACAACAAAATCAAATCA
AAACAGATCCGACAACAACAGAACAGTAAGCAATGGAGTGCGTATTTGGT
CTTGTCGGCGACGGCTTCGCAATCTTAGTGGCCGACACGTCGGCAGTCCA
CAGTATCTTGGTTCATAAATCGAACGAGGACAAGATCATGGTCCTCGACT
CTCACAAACTCATCGCCGCCAGTGGCGAACCCGGTGACCGTGTTCAATTT
ACGGAGTTCATTCAGAAGAATGTGTCGTTGTATCAATTTCGTAACGGAAT
TCCATTGACTACTGCTGCGGCGGCGAACTTTACCCGAGGAGAGCTTGCTA
CTGCTCTGAGAAAGAGCCCTTACATGGTTAACATCCTTCTAGCTGGGTAT
GACAAGGAGACAGGACCATCTCTTTACTACATTGACTACATTGCAACCCT
TCACAAAGTTGATAAGGCAGCTTTTGGTTATGGATCCTATTTTTCGCTCT
CCATGATGGACCGACATTTCCACAGTGGCATGTCAGTTGAAGAAGCTGTA
GACTTGGTTGATAAGTGCATACTGGAGATTCGATCCAGGCTGGTGGTGGC
ACCACCAAACTTTGTCATCAAGATTGTCGATAAGGATGGAGCACGGGAGT
ATGCTTGGCGTGAATCTGTCAAGGACACCCCTGTTTCTTCAGCATGAGGT
GGTCTGAATCTGAGTCGGACTTATTGGTATAATGTTATATTTGACTGCTC
AAAAACNNTT
back to top