DR406099

Overview
NameDR406099
Unique NameDR406099
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length712
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2589 contig Csv1_Contig2589:432..1130. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR406099 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSJ (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica GN=LTI6B PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 7.780e-20
Identity = 43/52 (82.69%), Postives = 47/52 (90.38%), Query Frame = 1
Query:  160 TVTCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 315
            T  C+DIL+A+ILPPLGVFLKFGC  EFWICLLLT LGYIPGIIYA+YAITK
Sbjct:    4 TANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55          
BLAST of DR406099 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSI (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica GN=LTI6B PE=3 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 7.780e-20
Identity = 43/52 (82.69%), Postives = 47/52 (90.38%), Query Frame = 1
Query:  160 TVTCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 315
            T  C+DIL+A+ILPPLGVFLKFGC  EFWICLLLT LGYIPGIIYA+YAITK
Sbjct:    4 TANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55          
BLAST of DR406099 vs. ExPASy Swiss-Prot
Match: LTI6A_ORYSJ (Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica GN=LTI6A PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.956e-19
Identity = 44/57 (77.19%), Postives = 49/57 (85.96%), Query Frame = 1
Query:  145 MADGSTVTCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 315
            MAD ST TC+DI+LA+ILPPLGVF KFGC  EFWICLLLT  GY+PGIIYAV+ ITK
Sbjct:    1 MAD-STATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVITK 56          
BLAST of DR406099 vs. ExPASy Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.467e-18
Identity = 40/53 (75.47%), Postives = 48/53 (90.57%), Query Frame = 1
Query:  157 STVTCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 315
            ST T V+I+LA+ILPPLGVFLKFGCK EFWICL+LT+ GY+PGI+YA+Y ITK
Sbjct:    2 STATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54          
BLAST of DR406099 vs. ExPASy Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.503e-18
Identity = 39/53 (73.58%), Postives = 48/53 (90.57%), Query Frame = 1
Query:  157 STVTCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 315
            ST T VDI++A++LPPLGVFL+FGC  EFWICL+LT+LGYIPGIIYA+Y +TK
Sbjct:    2 STATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54          
BLAST of DR406099 vs. ExPASy Swiss-Prot
Match: OSR8_ORYSJ (Hydrophobic protein OSR8 OS=Oryza sativa subsp. japonica GN=OSR8 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.382e-15
Identity = 40/56 (71.43%), Postives = 46/56 (82.14%), Query Frame = 1
Query:  145 MADGSTVTCVDILLAVILPPLGVFLKFGC-KAEFWICLLLTILGYIPGIIYAVYAI 309
            MA G   T ++ILLA+ILPPLGVFL+FGC   EF ICLLLTILGY+PGIIYAVY +
Sbjct:    1 MASGRCCTFLEILLAIILPPLGVFLRFGCCSMEFCICLLLTILGYVPGIIYAVYVL 56          
BLAST of DR406099 vs. ExPASy Swiss-Prot
Match: LT02_HORVU (Low temperature-induced protein lt101.2 OS=Hordeum vulgare GN=LT101.2 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.535e-15
Identity = 33/51 (64.71%), Postives = 45/51 (88.24%), Query Frame = 1
Query:  157 STVTCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 309
            ++ T ++++LA+ILPP+GVFL++G   EFWICLLLT+LGYIPGIIYAVY +
Sbjct:    2 ASATFIEVILAIILPPVGVFLRYGLAVEFWICLLLTLLGYIPGIIYAVYVL 52          
BLAST of DR406099 vs. ExPASy Swiss-Prot
Match: LT01_HORVU (Low temperature-induced protein lt101.1 OS=Hordeum vulgare GN=LT101.1 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.331e-14
Identity = 33/50 (66.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  160 TVTCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 309
            + T ++++LA+ILPP+GVFL++    EFWICLLLTILGYIPGIIYAVY +
Sbjct:    3 SATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVL 52          
BLAST of DR406099 vs. ExPASy Swiss-Prot
Match: ESI3_LOPEL (Salt stress-induced hydrophobic peptide ESI3 OS=Lophopyrum elongatum GN=ESI3 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.331e-14
Identity = 33/50 (66.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:  160 TVTCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 309
            + T ++++LA+ILPP+GVFL++    EFWICLLLTILGYIPGIIYAVY +
Sbjct:    3 SATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVL 52          
BLAST of DR406099 vs. ExPASy Swiss-Prot
Match: PMP3_DEBHA (Plasma membrane proteolipid 3 OS=Debaryomyces hansenii GN=PMP3 PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.680e-12
Identity = 34/53 (64.15%), Postives = 43/53 (81.13%), Query Frame = 1
Query:  166 TCVDI---LLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 315
            TC DI   ++A+ILPPLGVFL+ GC + FWI ++LTILGYIPGII+A+Y I K
Sbjct:    4 TCSDIFKIIIAIILPPLGVFLERGCASSFWINIVLTILGYIPGIIHALYVILK 56          
The following BLAST results are available for this feature:
BLAST of DR406099 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
LTI6B_ORYSJ7.780e-2082.69Hydrophobic protein LTI6B OS=Oryza sativa subsp. j... [more]
LTI6B_ORYSI7.780e-2082.69Hydrophobic protein LTI6B OS=Oryza sativa subsp. i... [more]
LTI6A_ORYSJ2.956e-1977.19Hydrophobic protein LTI6A OS=Oryza sativa subsp. j... [more]
RCI2B_ARATH1.467e-1875.47Hydrophobic protein RCI2B OS=Arabidopsis thaliana ... [more]
RCI2A_ARATH2.503e-1873.58Hydrophobic protein RCI2A OS=Arabidopsis thaliana ... [more]
OSR8_ORYSJ3.382e-1571.43Hydrophobic protein OSR8 OS=Oryza sativa subsp. ja... [more]
LT02_HORVU7.535e-1564.71Low temperature-induced protein lt101.2 OS=Hordeum... [more]
LT01_HORVU8.331e-1466.00Low temperature-induced protein lt101.1 OS=Hordeum... [more]
ESI3_LOPEL8.331e-1466.00Salt stress-induced hydrophobic peptide ESI3 OS=Lo... [more]
PMP3_DEBHA2.680e-1264.15Plasma membrane proteolipid 3 OS=Debaryomyces hans... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248L14 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248L14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR406099 ID=DR406099|Name=DR406099|organism=Citrus sinensis|type=EST|length=712bp
ACGGCCGGGGATAAACAAAAATACCAAGNNNNAATAACAAAAGCAGTTAC
TCAAAACCTTAAACACTTCTTTAATCAAAGTTCTTGTTTTTTGACTCTAA
ATTTTATTTTATTCCATTTTACACTTTTTAAGAATCAATCAAAGATGGCA
GATGGAAGCACAGTAACATGCGTAGATATTCTCTTGGCTGTTATCTTGCC
TCCTCTTGGTGTCTTTCTCAAATTTGGTTGCAAGGCTGAGTTTTGGATCT
GTTTGCTCTTGACAATTCTGGGGTATATCCCTGGAATTATTTATGCTGTT
TATGCCATCACCAAGAAGTGATCTCTCTTCTTCATCTATTGAGAGATCCC
AAGGGCATCATGTGTTTATGAGACCTTTTATTTACAACCGTTTGATGGAC
AGCTCTGATTTGATGTAGCCAGATGGGTTCTGATTCTTAATCAACTGGGG
TGTGCGTGTGTGTGGGAGAGAGCACTTGTTTCGTTTGTTAATCTTTGTCG
TTTTGTTTTCTTTAATTTGTCCTTTTTAATGAATTTTAATTCAATATGTT
GATGTAAAGTGGAGTATTATTGAGTGTGTAAATTGCCTTGTGAATCATTA
CAAGTCCCCACAAAACTAAATTTGTTCTGAATTATTGTGACTGCTGAATA
ATTACTAAATATTCTTTTTTGTTATTTTGTAGAAAGAACAAAACTGATTG
AGCGCAAAAAAA
back to top