DR406093

Overview
NameDR406093
Unique NameDR406093
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length753
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13714 contig Csv1_Contig13714:427..1177. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR406093 vs. ExPASy Swiss-Prot
Match: HSP17_ARATH (17.4 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.4A PE=1 SV=2)

HSP 1 Score: 211.46 bits (537), Expect = 4.117e-54
Identity = 102/158 (64.56%), Postives = 122/158 (77.22%), Query Frame = 1
Query:   76 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILLISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 549
            MSL+PS FGGRRTNVFDP SLDVWDPF+GFL+  LTNAP  A++ + F NA++DW+ETP+AHVFKAD+PGL+          G IL ISGERS E EEK+D WHRVERSSGKF+RRFRLP+NAKVE+VKASMENGVL+VT            +++ISG
Sbjct:    1 MSLVPSFFGGRRTNVFDPFSLDVWDPFEGFLTPGLTNAP--AKDVAAFTNAKVDWRETPEAHVFKADVPGLKKEEVKVEVEDGNILQISGERSSENEEKSDTWHRVERSSGKFMRRFRLPENAKVEEVKASMENGVLSVTVPKVQESKPEVKSVDISG 156          
BLAST of DR406093 vs. ExPASy Swiss-Prot
Match: HS181_ARATH (18.1 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 4.552e-53
Identity = 105/160 (65.62%), Postives = 123/160 (76.88%), Query Frame = 1
Query:   76 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFL--SSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILLISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 549
            MSLIPSIFGGRR+NVFDP S D+WDPF+GF   SSAL NA S+AR+ + F NAR+DWKETP+AHVFKADLPGL+            +L ISGERSKE EEKNDKWHRVER+SGKF+RRFRLP+NAK+E+VKA+MENGVLTV             +I+ISG
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSQDLWDPFEGFFTPSSALANA-STARDVAAFTNARVDWKETPEAHVFKADLPGLKKEEVKVEVEDKNVLQISGERSKENEEKNDKWHRVERASGKFMRRFRLPENAKMEEVKATMENGVLTVVVPKAPEKKPQVKSIDISG 159          
BLAST of DR406093 vs. ExPASy Swiss-Prot
Match: HS17C_ARATH (17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2)

HSP 1 Score: 207.994 bits (528), Expect = 4.552e-53
Identity = 106/159 (66.67%), Postives = 122/159 (76.73%), Query Frame = 1
Query:   76 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLS-SALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILLISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 549
            MSLIPSIFGGRRTNVFDP SLDV+DPF+GFL+ S L NAP  A + + F NA++DW+ETP+AHVFKADLPGLR          G IL ISGERS E EEKNDKWHRVERSSGKF RRFRLP+NAK+E++KASMENGVL+VT            +I+ISG
Sbjct:    1 MSLIPSIFGGRRTNVFDPFSLDVFDPFEGFLTPSGLANAP--AMDVAAFTNAKVDWRETPEAHVFKADLPGLRKEEVKVEVEDGNILQISGERSNENEEKNDKWHRVERSSGKFTRRFRLPENAKMEEIKASMENGVLSVTVPKVPEKKPEVKSIDISG 157          
BLAST of DR406093 vs. ExPASy Swiss-Prot
Match: HSP11_DAUCA (17.8 kDa class I heat shock protein OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 5.565e-51
Identity = 100/158 (63.29%), Postives = 117/158 (74.05%), Query Frame = 1
Query:   76 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILLISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 549
            MS+IPS FGGRR+NVFDP SLDVWDPF  F     ++A    +ET+ F N  IDWKETPQAHVFKADLPGL+          G++L ISGER+KE+EEKNDKWHRVERSSGKFLRRFRLP+NAKV++VKA+M NGV+TVT            AI+ISG
Sbjct:    1 MSIIPSFFGGRRSNVFDPFSLDVWDPFKDF-PLVTSSASEFGKETAAFVNTHIDWKETPQAHVFKADLPGLKKEEVKVELEEGKVLQISGERNKEKEEKNDKWHRVERSSGKFLRRFRLPENAKVDEVKAAMANGVVTVTVPKVEIKKPEVKAIDISG 157          
BLAST of DR406093 vs. ExPASy Swiss-Prot
Match: HSP16_SOYBN (18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.762e-50
Identity = 103/163 (63.19%), Postives = 118/163 (72.39%), Query Frame = 1
Query:   76 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGF-----LSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILLISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 549
            MSLIP+ FGGRR NVFDP SLDVWDPF  F     LSSA  + P  +RE S F + R+DWKETP+AHVFKAD+PGL+           ++L ISGER+ E+E+KND WHRVERSSGKF+RRFRLP+NAKVEQVKASMENGVLTVT            AIEISG
Sbjct:    1 MSLIPNFFGGRRNNVFDPFSLDVWDPFKDFPFPNTLSSA--SFPEFSRENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDKVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEISG 161          
BLAST of DR406093 vs. ExPASy Swiss-Prot
Match: HSP13_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-M PE=3 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.338e-49
Identity = 101/159 (63.52%), Postives = 116/159 (72.96%), Query Frame = 1
Query:   76 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSS-ARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILLISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 549
            MSLIPSIFGGRR+NVFDP SLDVWDPF  F      + P+S + E S F N R+DWKETP+AHVF+AD+PGL+           R+L ISGER+ E+E+KND WHRVERSSG F+RRFRLP+NAKVEQVKASMENGVLTVT            AIEISG
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSLDVWDPFKDF------HFPTSLSAENSAFVNTRVDWKETPEAHVFEADIPGLKKEEVKVQIEDDRVLQISGERNLEKEDKNDTWHRVERSSGNFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEISG 153          
BLAST of DR406093 vs. ExPASy Swiss-Prot
Match: HSP12_MEDSA (18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 3.053e-49
Identity = 96/158 (60.76%), Postives = 115/158 (72.78%), Query Frame = 1
Query:   76 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILLISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 549
            MSLIPS FGGRR+NVFDP SLDVWDPF  F  +    + S  RE S F + R+DWKETP+AHVFKADLPG++           R+L ISGERS E+E+KND+WHR+ERSSGKF+RRFRLP+NAK++QVKA+MENGVLTVT             I+ISG
Sbjct:    1 MSLIPSFFGGRRSNVFDPFSLDVWDPFKDFPFNNSALSASFPRENSAFVSTRVDWKETPEAHVFKADLPGMKKEEVKVEIEDDRVLQISGERSVEKEDKNDQWHRLERSSGKFMRRFRLPENAKMDQVKAAMENGVLTVTVPKEEVKKPEVKTIDISG 158          
BLAST of DR406093 vs. ExPASy Swiss-Prot
Match: HSP11_PEA (18.1 kDa class I heat shock protein OS=Pisum sativum GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 5.208e-49
Identity = 98/158 (62.03%), Postives = 114/158 (72.15%), Query Frame = 1
Query:   76 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILLISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 549
            MSLIPS F GRR+NVFDP SLDVWDP   F  S  + + S  RE   F + R+DWKETP+AHVFKADLPGL+           R+L ISGERS E+E+KND+WHRVERSSGKFLRRFRLP+NAK+++VKASMENGVLTVT            +IEISG
Sbjct:    1 MSLIPSFFSGRRSNVFDPFSLDVWDPLKDFPFSNSSPSASFPRENPAFVSTRVDWKETPEAHVFKADLPGLKKEEVKVEVEDDRVLQISGERSVEKEDKNDEWHRVERSSGKFLRRFRLPENAKMDKVKASMENGVLTVTVPKEEIKKAEVKSIEISG 158          
BLAST of DR406093 vs. ExPASy Swiss-Prot
Match: HSP11_SOYBN (17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 4.409e-48
Identity = 99/159 (62.26%), Postives = 115/159 (72.33%), Query Frame = 1
Query:   76 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSS-ARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILLISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 549
            MSLIPS FGGRR++VFDP SLDVWDPF  F        PSS + E S F + R+DWKETP+AHVFKAD+PGL+          GR+L ISGER+ E+E+KND WHRVERSSGK +RRFRLP+NAKV+QVKASMENGVLTVT            AI+ISG
Sbjct:    1 MSLIPSFFGGRRSSVFDPFSLDVWDPFKDF------PFPSSLSAENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKLEIQDGRVLQISGERNVEKEDKNDTWHRVERSSGKLVRRFRLPENAKVDQVKASMENGVLTVTVPKEEIKKPDVKAIDISG 153          
BLAST of DR406093 vs. ExPASy Swiss-Prot
Match: HSP14_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-E PE=3 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 2.188e-47
Identity = 97/160 (60.62%), Postives = 113/160 (70.62%), Query Frame = 1
Query:   76 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSA--RETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILLISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 549
            MSLIP  FGGRR+NVFDP SLD+WDPF  F      + P+S+   E S F + R+DWKETP+AHVFKAD+PGL+           R+L ISGER+ E+E+KND WHRVERSSGKF RRFRLP+NAKV +VKASMENGVLTVT            AIEISG
Sbjct:    1 MSLIPGFFGGRRSNVFDPFSLDMWDPFKDF------HVPTSSVSAENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFTRRFRLPENAKVNEVKASMENGVLTVTVPKEEVKKPDVKAIEISG 154          
The following BLAST results are available for this feature:
BLAST of DR406093 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
HSP17_ARATH4.117e-5464.5617.4 kDa class I heat shock protein OS=Arabidopsis... [more]
HS181_ARATH4.552e-5365.6318.1 kDa class I heat shock protein OS=Arabidopsis... [more]
HS17C_ARATH4.552e-5366.6717.6 kDa class I heat shock protein 3 OS=Arabidops... [more]
HSP11_DAUCA5.565e-5163.2917.8 kDa class I heat shock protein OS=Daucus caro... [more]
HSP16_SOYBN2.762e-5063.1918.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP13_SOYBN2.338e-4963.5217.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP12_MEDSA3.053e-4960.7618.2 kDa class I heat shock protein OS=Medicago sa... [more]
HSP11_PEA5.208e-4962.0318.1 kDa class I heat shock protein OS=Pisum sativ... [more]
HSP11_SOYBN4.409e-4862.2617.3 kDa class I heat shock protein OS=Glycine max... [more]
HSP14_SOYBN2.188e-4760.6317.5 kDa class I heat shock protein OS=Glycine max... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248L03 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248L03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR406093 ID=DR406093|Name=DR406093|organism=Citrus sinensis|type=EST|length=753bp
GGGGGATCTTCAAATTGATTGATCAAAGCATTTCCGAAGTTGTTGAGCAT
TTAATTAGCGTCCCAGTTTGCCATAATGTCACTCATTCCAAGCATCTTCG
GTGGCCGAAGAACCAACGTGTTCGATCCAGTTTCATTAGATGTATGGGAT
CCTTTCGACGGGTTCTTGTCCTCTGCCCTTACCAACGCGCCGTCTTCGGC
TAGGGAAACATCCCAATTCGCCAATGCAAGAATTGACTGGAAAGAGACTC
CTCAGGCTCACGTATTCAAAGCTGATCTTCCAGGGCTGAGGAAAGAAGAA
GTAAAAGTTGAGGTTGAAGAGGGCAGGATTCTGCTGATAAGCGGAGAGAG
GAGCAAGGAGCAGGAAGAGAAGAATGACAAGTGGCATCGCGTCGAGAGGA
GCAGTGGCAAGTTCCTGAGGAGGTTCAGGTTGCCCGACAATGCTAAGGTG
GAACAGGTTAAGGCCAGCATGGAGAATGGTGTGCTCACAGTCACCGTTCC
TAAACAGGAGGAGAAGAAACCTGAAGTTAAGGCTATTGAGATCTCTGGCT
AAGTGATAACTGTAGATGTTTTCAAGATAGTGTCTTTGGTTTGCTAATAA
ATTTGGTACGAAAGCAAAGCCCTTGTGTGTTTGTATGTNGTGTGTNGTGT
TCGTTTTCTTCCCTTCCCCCTGTTTAATTTNNNGTGANNNTGTTTGTGTG
TTTGCAAGAGCTTCAGGAGCCAGTCTCAAGCGTTGTAACTAGTTTTTTAA
TGA
back to top