DR405954

Overview
NameDR405954
Unique NameDR405954
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length578
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2614 contig Csv1_Contig2614:116..693. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405954 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 7.239e-22
Identity = 44/66 (66.67%), Postives = 53/66 (80.30%), Query Frame = 2
Query:   92 MSDXXGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 289
            MSD  GNCDCAD++QCVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:    1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of DR405954 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.413e-17
Identity = 43/65 (66.15%), Postives = 48/65 (73.85%), Query Frame = 2
Query:   92 MSDXXGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 286
            MSD  GNCDCAD SQCVKKG+S   D VETD S++  VV M V AAE+ G CKCG +C CVNCTC
Sbjct:    1 MSDKCGNCDCADSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of DR405954 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.147e-17
Identity = 37/62 (59.68%), Postives = 46/62 (74.19%), Query Frame = 2
Query:  107 GNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCGS 292
            GNCDC D+SQCVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C CG+
Sbjct:    5 GNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of DR405954 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.256e-15
Identity = 37/65 (56.92%), Postives = 44/65 (67.69%), Query Frame = 2
Query:   92 MSDXXGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 286
            MS    NCDC+D SQC KKG S+    VET+   + TV+ MD  AAE  GNCKCGP+CACV+C C
Sbjct:    1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of DR405954 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.847e-15
Identity = 38/66 (57.58%), Postives = 45/66 (68.18%), Query Frame = 2
Query:   92 MSDXXGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 289
            MS    NCDCAD +QCVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CTCG
Sbjct:    1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of DR405954 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.462e-14
Identity = 35/66 (53.03%), Postives = 42/66 (63.64%), Query Frame = 2
Query:   92 MSDXXGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 289
            MSD  GNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of DR405954 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.462e-14
Identity = 35/66 (53.03%), Postives = 42/66 (63.64%), Query Frame = 2
Query:   92 MSDXXGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 289
            MSD  GNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of DR405954 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.368e-12
Identity = 32/66 (48.48%), Postives = 40/66 (60.61%), Query Frame = 2
Query:   92 MSDXXGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 289
            MSD  GNCDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of DR405954 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.200e-12
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = 2
Query:   92 MSDXXGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 289
            MSD  G+CDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of DR405954 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA7.239e-2266.67Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_ACTDE1.413e-1766.15Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_MUSAC3.147e-1759.68Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_PRUAV2.256e-1556.92Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO3.847e-1557.58Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ1.462e-1453.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI1.462e-1453.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ1.368e-1248.48Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI5.200e-1246.97Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248E14 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248E14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405954 ID=DR405954|Name=DR405954|organism=Citrus sinensis|type=EST|length=578bp
GGGGATATCATCACAGCCCGTAAAGCAAGTTTCGTACAATAAAGAGCCCT
CTATTTCNNNNNNNAAATTCCAAGTTCTAAGCTCAATCAACATGTCGGAC
ANNNGCGGCAACTGCGACTGCGCTGACAGGAGCCAGTGTGTGAAGAAGGG
AAGCAGCTATGCTGCTGACTTCGTCGAGACTGACTTGAGCTTTGTCAGCA
CCGTTGTTGTCATGGACGTTCAGGCTGCTGAGACTGAAGGTAACTGCAAG
TGCGGCCCCACCTGCGCTTGTGTGAACTGCACTTGTGGTAGTCACTAATA
AGCAAACACATGCAGCAAAAAATAAGAAGCTGCAAGTGTGCCTAAATATT
GTGGGGGTTAAGAATAATGTAAGGGTGATTAAAAAAAAAAGAAAAATTCT
CTACTTCGTTTTTATGATGGTCTACTACTAGTGTGTGGAGTGATGTGCGT
GTTGTGTCACCCATCACTCGTAATGTTTTGTGTTTCCTTCTTCATAATCA
TGTAATATATGGCCATGGCCATGACCGTGGCCTTGTGTGGTTTAATTCCA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top