DR405951

Overview
NameDR405951
Unique NameDR405951
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length767
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10693 contig Csv1_Contig10693:103..884. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405951 vs. ExPASy Swiss-Prot
Match: MAN7_ARATH (Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis thaliana GN=MAN7 PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.037e-77
Identity = 111/169 (65.68%), Postives = 132/169 (78.11%), Query Frame = 1
Query:  103 MKLLHLAFTIFLAFFIHRQSFNV-LHVEAGDGFIRT*GSHFLLNGNLYYANGFNAYWLMYVDSDPSQRSKVSTAFHEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANNYDSFGGKKQYVNWARSQGQFLTSDDDFFRNPVVK 606
            MKLL  A   FLA  I    + +        GF+RT G  F LNG  YYANGFNAYWLMYV SDPSQRSK+STAF +A+ HGLTVARTWAFSDGGYR LQ SPGSYNE MF+GLDF +AEAR++GIK+ILS ANNY+SFGG+KQYV+WARS+G+ ++S+DDFF + +VK
Sbjct:    1 MKLL--ALFPFLAIVIQLSCWELGTDALPSGGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPSQRSKISTAFQDASRHGLTVARTWAFSDGGYRALQYSPGSYNEDMFQGLDFALAEARRHGIKIILSFANNYESFGGRKQYVDWARSRGRPVSSEDDFFTDSLVK 167          

HSP 2 Score: 89.7373 bits (221), Expect = 3.037e-77
Identity = 38/45 (84.44%), Postives = 42/45 (93.33%), Query Frame = 2
Query:  632 YNTFTGIHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWITEMASY 766
            +NTFT +HYKDDPTIMAWELMNEPRC SDPSGR IQAWITEMA++
Sbjct:  181 FNTFTKVHYKDDPTIMAWELMNEPRCPSDPSGRAIQAWITEMAAH 225          
BLAST of DR405951 vs. ExPASy Swiss-Prot
Match: MAN1_ORYSJ (Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa subsp. japonica GN=MAN1 PE=2 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 3.310e-73
Identity = 104/142 (73.24%), Postives = 119/142 (83.80%), Query Frame = 1
Query:  187 GDGFIRT*GSHFLLNGNLYYANGFNAYWLMYVDSDPSQRSKVSTAFHEAASHGLTVARTWAFSDGGY-RPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANNYDSFGGKKQYVNWARSQGQFLTSDDDFFRNPVVKG 609
            G GF+R  G+ F+L+GN YYANGFNAYWLM + +DPSQR KVS A  EAA HGLTVARTWAFSDGG    LQ SPG+YNE  FKGLDFV++EARKYGIK+ILSL +NYDSFGG+KQYVNWAR+QGQ + SDD+FF NPVVKG
Sbjct:   34 GGGFVRAQGTRFVLDGNPYYANGFNAYWLMLLAADPSQRGKVSAALGEAAGHGLTVARTWAFSDGGGGNALQLSPGNYNENTFKGLDFVLSEARKYGIKVILSLVDNYDSFGGRKQYVNWARAQGQGIGSDDEFFTNPVVKG 175          

HSP 2 Score: 79.7221 bits (195), Expect = 3.310e-73
Identity = 33/44 (75.00%), Postives = 40/44 (90.91%), Query Frame = 2
Query:  635 NTFTGIHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWITEMASY 766
            NT TG+ Y+DDPTI+AWELMNEPRC SD SGRT+Q+WITEMA++
Sbjct:  189 NTITGVAYRDDPTILAWELMNEPRCQSDLSGRTVQSWITEMAAH 232          
BLAST of DR405951 vs. ExPASy Swiss-Prot
Match: MAN4_SOLLC (Mannan endo-1,4-beta-mannosidase 4 OS=Solanum lycopersicum GN=MAN4 PE=1 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 6.090e-66
Identity = 93/142 (65.49%), Postives = 112/142 (78.87%), Query Frame = 1
Query:  184 AGDGFIRT*GSHFLLNGNLYYANGFNAYWLMYVDSDPSQRSKVSTAFHEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANNYDSFGGKKQYVNWARSQGQFLTSDDDFFRNPVVKG 609
            + + F+ T G+HF LNG   Y NGFNAYWLMY+  DPS R KV+  F +A+ + + VARTWAFS GG RPLQ +PG YNEQMF+GLDFVI+EA+KYGI LI+SL NN+D+FGGKKQYV WA  +GQ LTSDDDFF NP+VKG
Sbjct:   28 SNNNFVYTDGTHFALNGKSLYINGFNAYWLMYIAYDPSTRIKVTNTFQQASKYKMNVARTWAFSHGGSRPLQSAPGVYNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGGKKQYVEWAVQRGQKLTSDDDFFTNPMVKG 169          

HSP 2 Score: 70.4774 bits (171), Expect = 6.090e-66
Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 2
Query:  635 NTFTGIHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWITEMASY 766
            NT T + YKDDPTI++WEL+NEPRC SD SG+T Q W+ EMA Y
Sbjct:  183 NTITKVAYKDDPTILSWELINEPRCPSDLSGKTFQNWVLEMAGY 226          
BLAST of DR405951 vs. ExPASy Swiss-Prot
Match: MAN9_ORYSJ (Putative mannan endo-1,4-beta-mannosidase 9 OS=Oryza sativa subsp. japonica GN=MAN9 PE=2 SV=2)

HSP 1 Score: 189.889 bits (481), Expect = 1.919e-64
Identity = 91/141 (64.54%), Postives = 104/141 (73.76%), Query Frame = 1
Query:  184 AGDGFIRT*GSHFLLNGNLYYANGFNAYWLMYVDSDPSQRSKVSTAFHEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANNYDSFGGKKQYVNWARSQGQFLTSDDDFFRNPVVK 606
            A   F R  G+ F + G  +Y+NGFNAYWLMY+ SDP  RSK +    +AAS   T+ RTWAFSDGGYRPLQ+SPG YNE MF GLDFVIAEA+K G+ LILSL NN+D FGGKKQYV WAR QG  L SDDDFFR+ V K
Sbjct:   35 ANGQFARASGTRFTVGGRPFYSNGFNAYWLMYMASDPGDRSKAAGVLQQAASLRATLVRTWAFSDGGYRPLQKSPGVYNEDMFMGLDFVIAEAKKRGLYLILSLVNNWDGFGGKKQYVQWARDQGHNLGSDDDFFRSDVTK 175          

HSP 2 Score: 77.0258 bits (188), Expect = 1.919e-64
Identity = 32/44 (72.73%), Postives = 37/44 (84.09%), Query Frame = 2
Query:  635 NTFTGIHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWITEMASY 766
            N  TG+ YKDDPTI AWEL+NEPRC SD SG+T+QAW+TEMA Y
Sbjct:  188 NKITGVAYKDDPTIFAWELINEPRCQSDLSGKTLQAWVTEMAGY 231          
BLAST of DR405951 vs. ExPASy Swiss-Prot
Match: MAN4_ARATH (Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana GN=MAN4 PE=3 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 6.045e-63
Identity = 93/164 (56.71%), Postives = 120/164 (73.17%), Query Frame = 1
Query:  118 LAFTIFLAFFIHRQSFNVLHVEAGDGFIRT*GSHFLLNGNLYYANGFNAYWLMYVDSDPSQRSKVSTAFHEAASHGLTVARTWAFSDGG-YRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANNYDSFGGKKQYVNWARSQGQFLTSDDDFFRNPVVK 606
            L F + LA  I  QS+  +     DGF+   G  F+LNG  +YANGFNAYWL Y  +DP+ R K++  F  A S GLT+ARTW F DG  YR LQ +PGSY+EQ F+GLDFVIAEA++ GIKLI+ L NN+D +GGKKQYV+WARS+G+ ++S+DDF+RNPV+K
Sbjct:    4 LCFIVLLAIVI-AQSYVGVEAAPSDGFVSRNGVQFILNGKPFYANGFNAYWLAYEATDPTTRFKITNVFQNATSLGLTIARTWGFRDGAIYRALQTAPGSYDEQTFQGLDFVIAEAKRIGIKLIILLVNNWDDYGGKKQYVDWARSKGEVVSSNDDFYRNPVIK 166          

HSP 2 Score: 67.781 bits (164), Expect = 6.045e-63
Identity = 28/44 (63.64%), Postives = 34/44 (77.27%), Query Frame = 2
Query:  635 NTFTGIHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWITEMASY 766
            NTFT + YKD+P IMAW+LMNEPRC  D SG+T+  WI EMA +
Sbjct:  181 NTFTKVAYKDEPAIMAWQLMNEPRCGVDKSGKTLMDWINEMAPF 224          
BLAST of DR405951 vs. ExPASy Swiss-Prot
Match: MAN3_ARATH (Mannan endo-1,4-beta-mannosidase 3 OS=Arabidopsis thaliana GN=MAN3 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 8.586e-62
Identity = 84/164 (51.22%), Postives = 115/164 (70.12%), Query Frame = 1
Query:  118 LAFTIFLAFFIHRQSFNV-LHVEAGDGFIRT*GSHFLLNGNLYYANGFNAYWLMYVDSDPSQRSKVSTAFHEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANNYDSFGGKKQYVNWARSQGQFLTSDDDFFRNPVVK 606
            L F + LA  I + S ++ +   + DGF+   G  F+LNG  +YANGFNAYWL Y  +D + R K++  F  A  H LT+ RTW F DGGYR LQ +PG Y+E+ F+GLDF IAEA++ GIK+I++  NNY  FGG+KQYV+WA++ GQ ++SDDDF+ NP+VK
Sbjct:    4 LCFVVLLAILIAQNSSDLGVKSASSDGFVSRKGVQFILNGKPFYANGFNAYWLAYEATDSTTRFKITYVFQNATIHDLTIVRTWGFRDGGYRALQIAPGVYDEKTFQGLDFAIAEAKRLGIKMIITFVNNYSDFGGRKQYVDWAKNTGQNVSSDDDFYTNPLVK 167          

HSP 2 Score: 75.0998 bits (183), Expect = 8.586e-62
Identity = 30/44 (68.18%), Postives = 37/44 (84.09%), Query Frame = 2
Query:  635 NTFTGIHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWITEMASY 766
            NTFT + YKD+PTIM WELMNEP+C +DPSG+T+ AW+ EMA Y
Sbjct:  182 NTFTKVEYKDEPTIMGWELMNEPQCRADPSGKTLTAWMNEMALY 225          
BLAST of DR405951 vs. ExPASy Swiss-Prot
Match: MAN4_ORYSJ (Mannan endo-1,4-beta-mannosidase 4 OS=Oryza sativa subsp. japonica GN=MAN4 PE=2 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 1.458e-61
Identity = 85/144 (59.03%), Postives = 110/144 (76.39%), Query Frame = 1
Query:  178 VEAGDGFIRT*GSHFLLN-GNLYYANGFNAYWLMYVDSDPSQRSKVSTAFHEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANNYDSFGGKKQYVNWARSQGQFLTSDDDFFRNPVVK 606
            V  GDG +   G+ F+++ G   + +GFNAYWLM + +DP+ R  V+TAF +A++HGL +ARTWAFSDGG +PLQ SPG YNE MF+GLDFVIAEAR++GI L+L L NN+D+FGGK+QYV WA   G  LTSDDDFF + +VK
Sbjct:   17 VAPGDGMVAVDGTQFVVDCGRTIFFSGFNAYWLMMMAADPALRGAVATAFQQASAHGLNLARTWAFSDGGDQPLQSSPGVYNETMFQGLDFVIAEARRHGIYLLLCLTNNFDNFGGKRQYVRWAGDAGHNLTSDDDFFTSTIVK 160          

HSP 2 Score: 76.2554 bits (186), Expect = 1.458e-61
Identity = 31/44 (70.45%), Postives = 36/44 (81.82%), Query Frame = 2
Query:  635 NTFTGIHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWITEMASY 766
            NT TG+ YKDDPTI AWELMNEPRC +DP+G  +QAW+ EMA Y
Sbjct:  175 NTLTGVAYKDDPTIFAWELMNEPRCYADPTGAMVQAWVEEMAPY 218          
BLAST of DR405951 vs. ExPASy Swiss-Prot
Match: MAN5_SOLLC (Mannan endo-1,4-beta-mannosidase 5 OS=Solanum lycopersicum GN=MAN5 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 3.524e-60
Identity = 93/170 (54.71%), Postives = 119/170 (70.00%), Query Frame = 1
Query:  106 KLLHLAFTIFLAFFIHRQSFNVLHVE--AGD-GFIRT*GSHFLLNGNLYYANGFNAYWLMYVDSDPSQRSKVSTAFHEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANNYDSFGGKKQYVNWARSQGQFLTSDDDFFRNPVVK 606
            +L+   F +FL          VL  E  A D GF+R  G+HF LNG+ +  NGFN+YWLM+V ++PS+R KVS    EA+S GL+V RTWAFSDGG R LQ SPG Y+E++F+GLDFVI+EA+KYGI+LILS  NNY+ FGGK QYV WAR+ G  +  DDDF+ N + K
Sbjct:    6 RLISCIFVLFLLSLAFACEARVLLDENNANDQGFVRVNGAHFELNGSPFLFNGFNSYWLMHVAAEPSERYKVSEVLREASSAGLSVCRTWAFSDGGDRALQISPGVYDERVFQGLDFVISEAKKYGIRLILSFVNNYNDFGGKAQYVQWARNAGAQINGDDDFYTNYITK 175          

HSP 2 Score: 69.3218 bits (168), Expect = 3.524e-60
Identity = 30/45 (66.67%), Postives = 36/45 (80.00%), Query Frame = 2
Query:  632 YNTFTGIHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWITEMASY 766
            +NT TG+ YKDD TIMAWELMNEPR  +D SG T+ AW+ EMAS+
Sbjct:  189 FNTITGMTYKDDSTIMAWELMNEPRNQADYSGNTLNAWVQEMASF 233          
BLAST of DR405951 vs. ExPASy Swiss-Prot
Match: MAN2_SOLLC (Mannan endo-1,4-beta-mannosidase 2 OS=Solanum lycopersicum GN=MAN2 PE=2 SV=2)

HSP 1 Score: 183.341 bits (464), Expect = 3.524e-60
Identity = 93/170 (54.71%), Postives = 119/170 (70.00%), Query Frame = 1
Query:  106 KLLHLAFTIFLAFFIHRQSFNVLHVE--AGD-GFIRT*GSHFLLNGNLYYANGFNAYWLMYVDSDPSQRSKVSTAFHEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANNYDSFGGKKQYVNWARSQGQFLTSDDDFFRNPVVK 606
            +L+   F +FL          VL  E  A D GF+R  G+HF LNG+ +  NGFN+YWLM+V ++PS+R KVS    EA+S GL+V RTWAFSDGG R LQ SPG Y+E++F+GLDFVI+EA+KYGI+LILS  NNY+ FGGK QYV WAR+ G  +  DDDF+ N + K
Sbjct:    6 RLISCIFVLFLLSLAFACEARVLLDENNANDQGFVRVNGAHFELNGSPFLFNGFNSYWLMHVAAEPSERYKVSEVLREASSAGLSVCRTWAFSDGGDRALQISPGVYDERVFQGLDFVISEAKKYGIRLILSFVNNYNDFGGKAQYVQWARNAGAQINGDDDFYTNYITK 175          

HSP 2 Score: 69.3218 bits (168), Expect = 3.524e-60
Identity = 30/45 (66.67%), Postives = 36/45 (80.00%), Query Frame = 2
Query:  632 YNTFTGIHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWITEMASY 766
            +NT TG+ YKDD TIMAWELMNEPR  +D SG T+ AW+ EMAS+
Sbjct:  189 FNTITGMTYKDDSTIMAWELMNEPRNQADYSGNTLNAWVQEMASF 233          
BLAST of DR405951 vs. ExPASy Swiss-Prot
Match: MAN3_ORYSJ (Mannan endo-1,4-beta-mannosidase 3 OS=Oryza sativa subsp. japonica GN=MAN3 PE=2 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 8.494e-59
Identity = 84/149 (56.38%), Postives = 106/149 (71.14%), Query Frame = 1
Query:  163 FNVLHVEAGDGFIRT*GSHFLLNGN-LYYANGFNAYWLMYVDSDPSQRSKVSTAFHEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANNYDSFGGKKQYVNWARSQGQFLTSDDDFFRNPVVK 606
            F      AG G +   G+ F++ G    Y +GFNAYWLM + SDP++R+ V  AF +A+S GL +ARTWAFSDGG +PLQ SPG Y+E MF+GLDFVIAEAR++GI L+L L NN+D FGGK+QYV WA   G  LT+ DDFF + VVK
Sbjct:   18 FGAAAAAAGGGMVGVDGTQFVVEGGRTIYFSGFNAYWLMMMASDPARRAAVVAAFAQASSRGLNLARTWAFSDGGDQPLQSSPGVYDEAMFQGLDFVIAEARRHGIYLLLCLTNNFDDFGGKRQYVRWAADAGHNLTAGDDFFTSSVVK 166          

HSP 2 Score: 75.8702 bits (185), Expect = 8.494e-59
Identity = 31/44 (70.45%), Postives = 36/44 (81.82%), Query Frame = 2
Query:  635 NTFTGIHYKDDPTIMAWELMNEPRCTSDPSGRTIQAWITEMASY 766
            NT TG+ YKDDPTI AWELMNEPRC +DP+G  +QAW+ EMA Y
Sbjct:  181 NTVTGVAYKDDPTIFAWELMNEPRCDADPTGGMVQAWVEEMAPY 224          
The following BLAST results are available for this feature:
BLAST of DR405951 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
MAN7_ARATH3.037e-7765.68Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis ... [more]
MAN1_ORYSJ3.310e-7373.24Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa... [more]
MAN4_SOLLC6.090e-6665.49Mannan endo-1,4-beta-mannosidase 4 OS=Solanum lyco... [more]
MAN9_ORYSJ1.919e-6464.54Putative mannan endo-1,4-beta-mannosidase 9 OS=Ory... [more]
MAN4_ARATH6.045e-6356.71Putative mannan endo-1,4-beta-mannosidase 4 OS=Ara... [more]
MAN3_ARATH8.586e-6251.22Mannan endo-1,4-beta-mannosidase 3 OS=Arabidopsis ... [more]
MAN4_ORYSJ1.458e-6159.03Mannan endo-1,4-beta-mannosidase 4 OS=Oryza sativa... [more]
MAN5_SOLLC3.524e-6054.71Mannan endo-1,4-beta-mannosidase 5 OS=Solanum lyco... [more]
MAN2_SOLLC3.524e-6054.71Mannan endo-1,4-beta-mannosidase 2 OS=Solanum lyco... [more]
MAN3_ORYSJ8.494e-5956.38Mannan endo-1,4-beta-mannosidase 3 OS=Oryza sativa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248E11 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248E11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405951 ID=DR405951|Name=DR405951|organism=Citrus sinensis|type=EST|length=767bp
GGGGGCAGTTCTAAGAGGAAAAACTTCACGAGTTCACTAATAAAAATATA
GCCTCATCTCCACTGCTCCTTATCCACTCAGACACAGAGAGAGTGAAAGA
GGATGAAGCTCTTGCATTTAGCTTTCACAATCTTCTTAGCCTTTTTCATC
CACCGGCAATCTTTCAACGTCCTACATGTTGAAGCAGGAGATGGATTTAT
AAGAACATGAGGATCGCATTTTCTGTTGAATGGTAATCTTTACTATGCAA
ATGGATTTAATGCATATTGGTTGATGTATGTAGATTCTGACCCATCTCAG
AGATCCAAAGTATCAACTGCTTTTCATGAAGCTGCAAGCCATGGCCTCAC
TGTTGCCAGAACTTGGGCTTTCAGTGATGGTGGTTACAGACCCTTACAGC
GTTCCCCTGGCTCCTACAATGAGCAAATGTTTAAGGGATTGGATTTTGTG
ATAGCTGAGGCTAGAAAGTATGGGATCAAGCTCATATTGAGCTTGGCCAA
CAACTATGATAGTTTTGGAGGGAAGAAGCAGTATGTGAACTGGGCTAGAA
GTCAAGGCCAATTCCTCACATCTGATGATGATTTCTTCAGAAACCCTGTT
GTTAAGGGTTACTACAAGAACCTTATCAAGATATAATACCTTTACTGGAA
TTCACTACAAAGATGACCCGACAATTATGGCATGGGAGCTTATGAATGAG
CCGAGATGCACATCAGATCCCTCTGGAAGGACCATTCAGGCCTGGATAAC
GGAAATGGCTTCATATG
back to top