DR405938

Overview
NameDR405938
Unique NameDR405938
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length701
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DR405938 vs. ExPASy Swiss-Prot
Match: CYB52_ARATH (Probable cytochrome b5 isoform 2 OS=Arabidopsis thaliana GN=At2g32720 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.195e-26
Identity = 54/127 (42.52%), Postives = 90/127 (70.87%), Query Frame = 2
Query:  149 SKLYTMQEAAHHNTKDDCWIVVHNKVYDVTSYLDDHPGGDDVVLAATAKDATDEFEDAGHSKDARELLESFCIGELDTSSPLIPELEISSKRQP-------SDFALKLKNLTKQYWAAPVAVVGISV 508
            +K++T+ E + HN   DCWIV++ KVY+VT +L+DHPGGDDV+L++T KDATD+FED GHS+ ARE++E + +GE+D ++ +  +++ +  +QP       S+F +KL       +  P+A++G++V
Sbjct:    5 AKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSESAREMMEQYYVGEIDPTT-IPKKVKYTPPKQPHYNQDKTSEFIIKLLQ-----FLVPLAILGLAV 125          
BLAST of DR405938 vs. ExPASy Swiss-Prot
Match: CYB5_ORYSJ (Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 1.214e-25
Identity = 51/127 (40.16%), Postives = 89/127 (70.08%), Query Frame = 2
Query:  152 KLYTMQEAAHHNTKDDCWIVVHNKVYDVTSYLDDHPGGDDVVLAATAKDATDEFEDAGHSKDARELLESFCIGELDTSS------PLIPELEISSKRQPSDFALKLKNLTKQYWAAPVAVVGISVMV 514
            K+YT++E A HN+KDDCW+++  KVY+V+ +L+DHPGGDDV+L++T KDATD+FED GHS  AR +++ + +G++DTS+       + P+    ++ +  +F +K+       +  P+A++G++V +
Sbjct:    7 KVYTLEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSTTARAMMDEYYVGDIDTSTIPARTKYVPPKQPHYNQDKTPEFIIKILQ-----FLVPLAILGLAVAI 128          
BLAST of DR405938 vs. ExPASy Swiss-Prot
Match: CYB5_CUSRE (Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 3.532e-25
Identity = 53/130 (40.77%), Postives = 86/130 (66.15%), Query Frame = 2
Query:  149 SKLYTMQEAAHHNTKDDCWIVVHNKVYDVTSYLDDHPGGDDVVLAATAKDATDEFEDAGHSKDARELLESFCIGELDTS------SPLIPELEISSKRQPSDFALKLKNLTKQYWAAPVAVVGISVMVGF 520
            SK+Y++ E + H+  +DCW+V+  KVYDVT +LDDHPGG DV+L++TAKDATD+FED GHS  AR +++  C+G++D+S      S   P+  + ++ +   F +KL       +  P+ ++G++V + F
Sbjct:    4 SKVYSLAEVSEHSQPNDCWLVIGGKVYDVTKFLDDHPGGADVLLSSTAKDATDDFEDIGHSSSARAMMDEMCVGDIDSSTIPTKTSYTPPKQPLYNQDKTPQFIIKLLQ-----FLVPLIILGVAVGIRF 128          
BLAST of DR405938 vs. ExPASy Swiss-Prot
Match: CYB5_BOROF (Cytochrome b5 OS=Borago officinalis PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 6.025e-25
Identity = 46/95 (48.42%), Postives = 73/95 (76.84%), Query Frame = 2
Query:  146 LSKLYTMQEAAHHNTKDDCWIVVHNKVYDVTSYLDDHPGGDDVVLAATAKDATDEFEDAGHSKDARELLESFCIGELDTSSPLIPELEISSKRQP 430
            + K++T+ E A HN   DCW++++ KVYDVT +L+DHPGGDDV+L+AT KDATD+FED GHS  A+ +L+ + +G++D+SS +  +++ +  +QP
Sbjct:    1 MGKIFTLAEVAQHNNSKDCWLIINGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFEDIGHSSSAKAMLDEYYVGDIDSSS-IPSQVKYTPPKQP 94          
BLAST of DR405938 vs. ExPASy Swiss-Prot
Match: CYB5_TOBAC (Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.342e-24
Identity = 53/131 (40.46%), Postives = 85/131 (64.89%), Query Frame = 2
Query:  149 SKLYTMQEAAHHNTKDDCWIVVHNKVYDVTSYLDDHPGGDDVVLAATAKDATDEFEDAGHSKDARELLESFCIGELDTSSPLIPELEISSKRQP-------SDFALKLKNLTKQYWAAPVAVVGISVMVGF 520
            +K++T+ E + HN   DCW+V+  KVYDVT +LDDHPGGD+V+L+AT KDATD+FED GHS  AR +L+ + +G++D S+ +  + + +   QP       S+F +KL       +  P+ ++G++  + F
Sbjct:    5 TKVFTLAEVSQHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSARAMLDEYYVGDID-SATIPTKTKYTPPNQPHYNQDKTSEFVVKLLQ-----FLVPLIILGVAFGIRF 129          
BLAST of DR405938 vs. ExPASy Swiss-Prot
Match: CYB5S_TOBAC (Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.938e-23
Identity = 51/131 (38.93%), Postives = 87/131 (66.41%), Query Frame = 2
Query:  149 SKLYTMQEAAHHNTKDDCWIVVHNKVYDVTSYLDDHPGGDDVVLAATAKDATDEFEDAGHSKDARELLESFCIGELDTSSPLIPELEISSKRQP-------SDFALKLKNLTKQYWAAPVAVVGISVMVGF 520
            SK++T+ E ++HN   DCW+++  KVY+VT +L+DHPGG +V+L+AT KDATD+FED GHS  AR +L+ + +G++D SS +  +++ +  +QP       ++F +KL       +  P+ ++G++  V F
Sbjct:    5 SKVFTLAEVSNHNNAKDCWLIISGKVYNVTKFLEDHPGGGEVLLSATGKDATDDFEDIGHSSSARAMLDEYYVGDID-SSTIPTKVKYTPPKQPHYNQDKTTEFIVKLLQ-----FLVPLIILGVAFGVHF 129          
BLAST of DR405938 vs. ExPASy Swiss-Prot
Match: CYB51_ARATH (Cytochrome b5 isoform 1 OS=Arabidopsis thaliana GN=At5g53560 PE=2 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 3.306e-23
Identity = 47/127 (37.01%), Postives = 85/127 (66.93%), Query Frame = 2
Query:  152 KLYTMQEAAHHNTKDDCWIVVHNKVYDVTSYLDDHPGGDDVVLAATAKDATDEFEDAGHSKDARELLESFCIGELDTSSP------LIPELEISSKRQPSDFALKLKNLTKQYWAAPVAVVGISVMV 514
            K+ + +E + HN   DCW+++  KVYDVT ++DDHPGGD+V+L++T KDAT++FED GHS  AR++++ + IGE+D+SS       + P+    ++ +  +F +K+       +  P+ ++G++++V
Sbjct:    6 KVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARDMMDKYFIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQ-----FLVPILILGLALVV 127          
BLAST of DR405938 vs. ExPASy Swiss-Prot
Match: CYB5_BRAOB (Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 9.619e-23
Identity = 48/132 (36.36%), Postives = 85/132 (64.39%), Query Frame = 2
Query:  137 MPTLSKLYTMQEAAHHNTKDDCWIVVHNKVYDVTSYLDDHPGGDDVVLAATAKDATDEFEDAGHSKDARELLESFCIGELDTSSP------LIPELEISSKRQPSDFALKLKNLTKQYWAAPVAVVGISVMV 514
            M +  K+   +E + HN   DCW+++  KVYDVT ++DDHPGGD+V+L++T KDAT++FED GHS  AR+++E + IGE+D+S+       + P     ++ +  +F +K+       +  P+ ++G++++V
Sbjct:    1 MASEKKVLGFEEVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARDMMEKYYIGEIDSSTVPATRTYVAPVQPAYNQDKTPEFMIKILQ-----FLVPILILGLALVV 127          
BLAST of DR405938 vs. ExPASy Swiss-Prot
Match: CYB5_RHIST (Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.176e-20
Identity = 40/80 (50.00%), Postives = 61/80 (76.25%), Query Frame = 2
Query:  149 SKLYTMQEAAHHNTKDDCWIVVHNKVYDVTSYLDDHPGGDDVVLAATAKDATDEFEDAGHSKDARELLESFCIGELDTSS 388
            +K++++ E + H TK D W+V+HNKVYD+T ++ +HPGG++V++    KDAT+ FED GHS +ARE+LE + IG LD +S
Sbjct:    3 AKIFSLDEVSKHKTKSDLWVVIHNKVYDITRFVVEHPGGEEVLVDEGGKDATEAFEDIGHSDEAREMLEEYLIGSLDEAS 82          
BLAST of DR405938 vs. ExPASy Swiss-Prot
Match: CYB5_DROME (Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.620e-20
Identity = 41/95 (43.16%), Postives = 65/95 (68.42%), Query Frame = 2
Query:  149 SKLYTMQEAAHHNTKDDCWIVVHNKVYDVTSYLDDHPGGDDVVLAATAKDATDEFEDAGHSKDARELLESFCIGELDTSSPLIPELEISSKRQPS 433
            +K +T  E A HNT  D W+++HN +YDVT++L++HPGG++V++    KDAT+ FED GHS DAR++++ + IGEL  S        ++ K +P+
Sbjct:    6 TKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDARDMMKKYKIGELVESE----RTSVAQKSEPT 96          
The following BLAST results are available for this feature:
BLAST of DR405938 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
CYB52_ARATH3.195e-2642.52Probable cytochrome b5 isoform 2 OS=Arabidopsis th... [more]
CYB5_ORYSJ1.214e-2540.16Cytochrome b5 OS=Oryza sativa subsp. japonica GN=O... [more]
CYB5_CUSRE3.532e-2540.77Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1[more]
CYB5_BOROF6.025e-2548.42Cytochrome b5 OS=Borago officinalis PE=2 SV=1[more]
CYB5_TOBAC1.342e-2440.46Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1[more]
CYB5S_TOBAC1.938e-2338.93Cytochrome b5, seed isoform OS=Nicotiana tabacum P... [more]
CYB51_ARATH3.306e-2337.01Cytochrome b5 isoform 1 OS=Arabidopsis thaliana GN... [more]
CYB5_BRAOB9.619e-2336.36Cytochrome b5 OS=Brassica oleracea var. botrytis G... [more]
CYB5_RHIST1.176e-2050.00Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1[more]
CYB5_DROME2.620e-2043.16Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248D21 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248D21 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405938 ID=DR405938|Name=DR405938|organism=Citrus sinensis|type=EST|length=701bp
GGGGTTTAACCCGAGAGACAGAAAACGGGCCTGAGATGCCAAATCCCAAT
TCTCGAGCACAGGGTTGAAGGTGAGGATCTCAGAAAATCTTGTTGAGAGA
GAGGGAGAGCGGCTGACCAAAAGCCCACCAATAAAGATGCCGACTCTCTC
AAAGCTCTACACGATGCAAGAAGCTGCTCACCACAACACCAAAGACGATT
GCTGGATTGTCGTTCATAACAAGGTGTATGATGTCACTTCATATTTGGAC
GATCATCCTGGTGGAGATGATGTAGTTCTTGCTGCAACGGCAAAAGATGC
AACAGACGAATTTGAAGATGCTGGGCATAGCAAAGATGCAAGGGAACTCC
TGGAGAGCTTTTGTATCGGTGAACTTGACACTTCATCTCCATTGATCCCA
GAACTTGAGATTTCGTCTAAAAGGCAACCGTCAGATTTTGCACTAAAGCT
CAAGAACTTGACAAAGCAATACTGGGCTGCTCCTGTTGCTGTTGTTGGCA
TCTCCGTGATGGTTGGCTTCTTGTGCTTGCGCAAGAAGTGAACCAACGCA
TCTCCATTAAACTGTCTAGTATGCTTGCATGAAATTTTGGAATTGCAAAA
GCAGGCTATAATTTATAGAAAAACGGTGACGCACAATAATTTCTCTTTTC
TATTTTTATTTTTTTAAGAGTTCTACATAAAAAAAAAAAAAAAAAAAAAA
A
back to top