CX069797
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX069797 vs. ExPASy Swiss-Prot
Match: Y4158_ARATH (B3 domain-containing protein At4g01580 OS=Arabidopsis thaliana GN=At4g01580 PE=2 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 3.793e-13 Identity = 43/103 (41.75%), Postives = 59/103 (57.28%), Query Frame = 1 Query: 304 FFREILAFTIDDKELMLPPRFVKIFGDELSFDATITKS*C*CFTSRYYKR*RK---------FGDGWNEFLECHSICFGYKILFQYRKNSNFHVVIFGIDNCE 585 FF+ +L T+ DK + +PPRFVK+ G +LS T+ T YKR K F +GW+EF E HSI G+ +LF+Y+KNS+F V+IF CE Sbjct: 30 FFKLVLPSTMKDKMMRIPPRFVKLQGSKLSEVVTLV-------TPAGYKRSIKLKRIGEEIWFHEGWSEFAEAHSIEEGHFLLFEYKKNSSFRVIIFNASACE 125
BLAST of CX069797 vs. ExPASy Swiss-Prot
Match: Y3896_ARATH (B3 domain-containing protein At3g18960 OS=Arabidopsis thaliana GN=At3g18960 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 1.441e-12 Identity = 41/103 (39.81%), Postives = 60/103 (58.25%), Query Frame = 1 Query: 304 FFREILAFTIDDKELMLPPRFVKIFGDELSFDATITKS*C*CFTSRYYKR*RK---------FGDGWNEFLECHSICFGYKILFQYRKNSNFHVVIFGIDNCE 585 FF+ +L T+ DK + +PPRFVK+ G +LS T+ T +KR K F +GW+EF E HSI G+ +LF+Y++NS+F V+IF + CE Sbjct: 30 FFKLVLPSTMKDKMMKIPPRFVKLQGSKLSEVVTLE-------TPAGFKRSIKLKRIGEEIWFHEGWSEFAEAHSIEEGHFLLFEYKENSSFRVIIFNVSACE 125 The following BLAST results are available for this feature:
BLAST of CX069797 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX069797 ID=CX069797; Name=CX069797; organism=Citrus sinensis; type=EST; length=789bpback to top |