DR404008

Overview
NameDR404008
Unique NameDR404008
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length533
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DR404008_ssr469 microsatellite DR404008_ssr469:469..480. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13796 contig Csv1_Contig13796:854..1386. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR404008 vs. ExPASy Swiss-Prot
Match: PER42_ARATH (Peroxidase 42 OS=Arabidopsis thaliana GN=PER42 PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 1.458e-23
Identity = 52/64 (81.25%), Postives = 57/64 (89.06%), Query Frame = 3
Query:    3 GLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLANKLH 194
            GL++VDHQLA DKRTRP VKKMAK Q YFFKEF+RAI +LSENNPLTG+KGEIRK CNLANK H
Sbjct:  267 GLLLVDHQLAHDKRTRPIVKKMAKDQAYFFKEFTRAIQILSENNPLTGSKGEIRKQCNLANKNH 330          
BLAST of DR404008 vs. ExPASy Swiss-Prot
Match: PER21_ARATH (Peroxidase 21 OS=Arabidopsis thaliana GN=PER21 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.601e-14
Identity = 35/61 (57.38%), Postives = 45/61 (73.77%), Query Frame = 3
Query:    3 GLMMVDHQLATDKRTRPYVKKMAKSQDYFFKEFSRAITLLSENNPLTGTKGEIRKVCNLAN 185
            GL+++D +LATD RT P+V KMA   +YF ++FSR + LLSE NPLTG +GEIRK C   N
Sbjct:  267 GLLVIDDELATDPRTAPFVAKMAADNNYFHEQFSRGVRLLSETNPLTGDQGEIRKDCRYVN 327          
The following BLAST results are available for this feature:
BLAST of DR404008 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PER42_ARATH1.458e-2381.25Peroxidase 42 OS=Arabidopsis thaliana GN=PER42 PE=... [more]
PER21_ARATH3.601e-1457.38Peroxidase 21 OS=Arabidopsis thaliana GN=PER21 PE=... [more]
back to top
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCSAH-PNP1246P21 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone CSAH-PNP1246P21 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR404008 ID=DR404008|Name=DR404008|organism=Citrus sinensis|type=EST|length=533bp
GGGGCTTGATGATGGTTGATCATCAGCTAGCCACCGACAAGAGGACAAGA
CCTTATGTTAAGAAGATGGCCAAGAGTCAAGACTACTTCTTCAAGGAATT
TTCAAGAGCCATTACTCTCCTTTCTGAGAACAACCCTCTCACAGGTACAA
AGGGTGAGATCCGAAAGGTTTGCAATCTTGCCAACAAGCTCCACGACAAG
TCCTAGCCAGCTAACAGCTGTATTAGCTACAACAAGTTAATAGCTCCAAA
TTTTTCTTCCTTGTTTCTTCTATGAGGAAGAAAAGAGTGTGAGATGAGCT
CCCAATAAGATGGTTTTTCTAGATCGGTTTGTTTCCTGTGAGATGTTCGT
ATTACTGCTATTATGTTCCTTAGATGTACCGTCCAATGTTTAAGCCTAGG
CTTTCCTTCTCCTCGATGGTGTGAGCTTGATGTTATTAATATTCAGTAAT
GGCAGTGGTAGATGAGGGATGTATGTATGTATGCAGGGATGGTGTATGGT
GCATGGATTTGTATAATGATGATAATTGATGAT
back to top