DR404004

Overview
NameDR404004
Unique NameDR404004
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length711
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3940 contig Csv1_Contig3940:251..961. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR404004 vs. ExPASy Swiss-Prot
Match: XYL1_ARATH (Alpha-xylosidase OS=Arabidopsis thaliana GN=XYL1 PE=1 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 4.200e-74
Identity = 138/204 (67.65%), Postives = 168/204 (82.35%), Query Frame = 1
Query:    4 PPXSWYNVFDMTQAISSKDGKFVTLDAPLHVVNVHLYQNTILPMQQGGLISKEARMTPFSLVVTFPAGASGVQAKGKLYLDEDELPEMKLGNGYSTYVDFFATTGNGTVKIWSEVQEGKFALSKGWIIDSVTVLGLGGSGKASTLEINGSPTNANSKIEFNASEQKHLNSVEDEQ--KSVMVGIKGLGFPVGKNFVMSWKMGIS 609
            PP SWY++FDMTQA+ SK+GK VTL APL+ VNVHLYQNTILP QQGGLISK+AR TPFSLV+ FPAGAS   A GKLYLDEDELPEMKLGNG STYVDF+A+ GNGT+K+WS+V+EGKFALSKGW+I+ V+VLGL G+G+ S ++INGSP     KIE ++ E  ++  +EDE+  KSVMV ++GL   VGK+F MSWKMGI+
Sbjct:  714 PPGSWYHMFDMTQAVVSKNGKRVTLPAPLNFVNVHLYQNTILPTQQGGLISKDARTTPFSLVIAFPAGASEGYATGKLYLDEDELPEMKLGNGQSTYVDFYASVGNGTMKMWSQVKEGKFALSKGWVIEKVSVLGLRGAGQVSEIQINGSP--MTKKIEVSSKEHTYVIGLEDEEENKSVMVEVRGLEMLVGKDFNMSWKMGIN 915          
BLAST of DR404004 vs. ExPASy Swiss-Prot
Match: AGLU_SPIOL (Alpha-glucosidase OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.187e-22
Identity = 68/195 (34.87%), Postives = 104/195 (53.33%), Query Frame = 1
Query:    4 PPXSWYNVFDMTQAISSKDGKFVTLDAPLHVVNVHLYQNTILPMQQGGLISKEARMTPFS-LVVTFPAGASGVQAKGKLYLDEDELPEMKLGNGYSTYVDFFATTGNGTVKIWSEVQEGKFALSKGWIIDSVTVLGLGGSGKASTLEINGSPTNANSKIEFNASEQKHLNSVEDEQKSVMVG-IKGLGFPVGKNF 582
            P  +W+++FD T+++++  G++VTL AP   +NVH+ +  IL MQ   + ++ AR TPF  LVV    GAS     G+L+LD+     M +  G  T+V F A +   T  I S+V  G+FA+S+ W+ID VT+LGL    K     ING      +       ++  L S  D +   +V  I GL   +G+ F
Sbjct:  715 PRGNWFDLFDYTRSVTASTGRYVTLSAPPDHINVHIQEGNILAMQGKAMTTQAARKTPFHLLVVMSDCGAS----FGELFLDDGVEVTMGVNRGKWTFVKFIAASAKQTCIITSDVVSGEFAVSQKWVIDKVTILGLRKGTK-----INGYTVRTGAVT--RKGDKSKLKSTPDRKGEFIVAEISGLNLLLGREF 898          
BLAST of DR404004 vs. ExPASy Swiss-Prot
Match: AGLU_HORVU (Alpha-glucosidase OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.614e-17
Identity = 63/202 (31.19%), Postives = 94/202 (46.53%), Query Frame = 1
Query:    4 PPXSWYNVFDMTQAISSKDGKFVTLDAPLHVVNVHLYQNTILPMQQGGLISKEARMTPFSLVVTFPAGASGVQAKGKLYLDEDELPEMKLGNGYS-TYVDFFATTGNGTVKIWSEVQEGKFALSKGWIIDSVTVLG--LGGSGKASTLEINGSPTNANSKIEFNASEQKHLNSVEDEQKSVMVGIKGLGFPVGKNFVMSWKM 600
            P   WY ++D + A++++ GK V L AP   VNVHL   TILP+QQ  L +  AR T F L+V   A A    A G L+LD+ + PE    + +S    ++      G +K+ SEV    +A S+  +I  V ++G     + K  T+ +N +   A+S           L  V          I GL   VG+ F +   M
Sbjct:  685 PAGRWYRLYDYSLAVATRTGKHVRLPAPADTVNVHLTGGTILPLQQSALTTSRARRTAFHLLV---ALAEDGTASGYLFLDDGDSPEYGRRSDWSMVRFNYKIPNNKGAIKVKSEVVHNSYAQSRTLVISKVVLMGHRSPAAPKKLTVHVNSAEVEASSSAGTRYQNAGGLGGV--------AHIGGLSLVVGEEFELKVAM 875          
BLAST of DR404004 vs. ExPASy Swiss-Prot
Match: AGLU_BETVU (Alpha-glucosidase OS=Beta vulgaris PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.995e-16
Identity = 49/138 (35.51%), Postives = 80/138 (57.97%), Query Frame = 1
Query:    4 PPXSWYNVFDMTQAISSKDGKFVTLDAPLHVVNVHLYQNTILPMQQGGLISKEARMTPFSLVVTFPAGASGVQAKGKLYLDEDELPEMKLG--NGYSTYVDFFATTGNGTVKIWSEVQEGKFALSKGWIIDSVTVLGL 411
            P  +W ++ + T ++S   G +V+L AP   +NVH+++  I+ MQ   + ++ AR TPF L+V     +  V + G+L+LD     EM +G   G  T V FFA +G   + I SEV    +A+S+ W++D +T+LGL
Sbjct:  719 PRGNWVSLSNYTSSVSVSAGTYVSLSAPPDHINVHIHEGNIVAMQGEAMTTQAARSTPFHLLVVM---SDHVASTGELFLDNG--IEMDIGGPGGKWTLVRFFAESGINNLTISSEVVNRGYAMSQRWVMDKITILGL 851          
BLAST of DR404004 vs. ExPASy Swiss-Prot
Match: AGLU_ORYSJ (Probable alpha-glucosidase Os06g0675700 OS=Oryza sativa subsp. japonica GN=Os06g0675700 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.418e-15
Identity = 54/162 (33.33%), Postives = 81/162 (50.00%), Query Frame = 1
Query:    4 PPXSWYNVFDMTQAISSKDGKFVTLDAPLHVVNVHLYQNTILPMQQGGLISKEARMTPFSLVVTFPAGASGVQAKGKLYLDEDELPEMKLGNGYSTYVDFFATT--GNGTVKIWSEVQEGKFALSKGWIIDSVTVLGLGGSG--KASTLEINGSPTNANSKI 477
            P   W++++D + A+++K GK VTL AP   VNVH+    IL +QQ  L S   R +   L+V   A A    A G L+LD+ E PEM       + + F   T  G G V++ S V    +A S+   I  V ++GL  +   K   +  NG   NA++ +
Sbjct:  691 PAGRWFSLYDFSLAVATKTGKRVTLPAPADTVNVHVAGGNILTLQQPALTSSRVRQSVVHLLV---ALADDGTATGDLFLDDGESPEMAGPRSRWSQIKFSGATESGGGVVRVRSHVVHDSYAPSRTMAIGKVVLMGLRSAAPPKGFAVYANGVQVNASTAV 849          
The following BLAST results are available for this feature:
BLAST of DR404004 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
XYL1_ARATH4.200e-7467.65Alpha-xylosidase OS=Arabidopsis thaliana GN=XYL1 P... [more]
AGLU_SPIOL2.187e-2234.87Alpha-glucosidase OS=Spinacia oleracea PE=1 SV=1[more]
AGLU_HORVU3.614e-1731.19Alpha-glucosidase OS=Hordeum vulgare PE=2 SV=1[more]
AGLU_BETVU3.995e-1635.51Alpha-glucosidase OS=Beta vulgaris PE=1 SV=1[more]
AGLU_ORYSJ4.418e-1533.33Probable alpha-glucosidase Os06g0675700 OS=Oryza s... [more]
back to top
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCSAH-PNP1246P15 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone CSAH-PNP1246P15 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR404004 ID=DR404004|Name=DR404004|organism=Citrus sinensis|type=EST|length=711bp
GGGCCTCCNNGTAGTTGGTACAATGTGTTTGATATGACACAAGCCATTTC
ATCGAAAGATGGGAAATTTGTTACCCTTGATGCACCTTTACATGTGGTTA
ACGTGCACTTGTACCAGAATACCATCCTTCCAATGCAGCAAGGTGGACTA
ATTTCCAAGGAAGCTAGAATGACGCCTTTTAGCCTCGTAGTGACCTTCCC
TGCAGGAGCAAGTGGGGTACAAGCCAAAGGAAAACTTTACCTTGACGAGG
ATGAGCTTCCAGAGATGAAACTTGGGAATGGGTACTCGACATATGTTGAT
TTTTTTGCTACCACTGGTAACGGAACTGTGAAGATTTGGTCAGAAGTTCA
GGAGGGCAAGTTTGCTTTAAGTAAGGGTTGGATCATTGATAGTGTAACTG
TGCTGGGATTAGGTGGAAGTGGCAAGGCATCTACACTTGAGATTAATGGA
AGCCCCACAAATGCTAACTCGAAAATAGAATTCAATGCATCAGAACAGAA
GCACTTGAATTCGGTGGAGGATGAGCAAAAGAGTGTGATGGTAGGGATCA
AGGGTCTCGGTTTTCCGGTGGGCAAAAATTTTGTCATGTCCTGGAAAATG
GGGATAAGTGGTTGAGGCATCTTTTATTTTCAGATAAATTTATTGTGATT
CCTTTGTTTAGCCTTCTTTTGGTCATTATGATTTTTAATGTTTTCTTATT
AGGTTTGTGGA
back to top