DR404003

Overview
NameDR404003
Unique NameDR404003
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length422
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6283 contig Csv1_Contig6283:171..592. BLAST: Citrus Unigene V1 Contigs to Populus V2 proteins
Homology
BLAST of DR404003 vs. ExPASy Swiss-Prot
Match: PSBK_CITSI (Photosystem II reaction center protein K OS=Citrus sinensis GN=psbK PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 3.910e-28
Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 2
Query:  182 MLNIFSLMYICLNSALYSSSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 364
            MLNIFSLMYICLNSALYSSSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR
Sbjct:    1 MLNIFSLMYICLNSALYSSSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 61          
BLAST of DR404003 vs. ExPASy Swiss-Prot
Match: PSBK_JASNU (Photosystem II reaction center protein K OS=Jasminum nudiflorum GN=psbK PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.098e-25
Identity = 56/61 (91.80%), Postives = 57/61 (93.44%), Query Frame = 2
Query:  182 MLNIFSLMYICLNSALYSSSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 364
            MLNIFSL+ ICLNSALYSSSF F KLPEAYAFLNPIVDVMPVIPV FFLLAFVWQAAVSFR
Sbjct:    1 MLNIFSLISICLNSALYSSSFFFGKLPEAYAFLNPIVDVMPVIPVFFFLLAFVWQAAVSFR 61          
BLAST of DR404003 vs. ExPASy Swiss-Prot
Match: PSBK_VITVI (Photosystem II reaction center protein K OS=Vitis vinifera GN=psbK PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 5.284e-25
Identity = 55/61 (90.16%), Postives = 58/61 (95.08%), Query Frame = 2
Query:  182 MLNIFSLMYICLNSALYSSSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 364
            MLNIFSL+ ICLNSALYSS+F FAKLPEAYAFLNPIVDVMPVIP+ FFLLAFVWQAAVSFR
Sbjct:    1 MLNIFSLICICLNSALYSSNFFFAKLPEAYAFLNPIVDVMPVIPLFFFLLAFVWQAAVSFR 61          
BLAST of DR404003 vs. ExPASy Swiss-Prot
Match: PSBK_MORIN (Photosystem II reaction center protein K OS=Morus indica GN=psbK PE=3 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 6.901e-25
Identity = 56/61 (91.80%), Postives = 57/61 (93.44%), Query Frame = 2
Query:  182 MLNIFSLMYICLNSALYSSSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 364
            MLNIFSL+ ICLNS LYSSSF  AKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR
Sbjct:    1 MLNIFSLICICLNSVLYSSSFFVAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 61          
BLAST of DR404003 vs. ExPASy Swiss-Prot
Match: PSBK_GOSHI (Photosystem II reaction center protein K OS=Gossypium hirsutum GN=psbK PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 9.013e-25
Identity = 55/61 (90.16%), Postives = 58/61 (95.08%), Query Frame = 2
Query:  182 MLNIFSLMYICLNSALYSSSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 364
            MLNIF+L+ IC NSAL+SSSFLFAKLPEAYAFLNPIVD MPVIPVLFFLLAFVWQAAVSFR
Sbjct:    1 MLNIFNLICICFNSALFSSSFLFAKLPEAYAFLNPIVDFMPVIPVLFFLLAFVWQAAVSFR 61          
BLAST of DR404003 vs. ExPASy Swiss-Prot
Match: PSBK_GOSBA (Photosystem II reaction center protein K OS=Gossypium barbadense GN=psbK PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 9.013e-25
Identity = 55/61 (90.16%), Postives = 58/61 (95.08%), Query Frame = 2
Query:  182 MLNIFSLMYICLNSALYSSSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 364
            MLNIF+L+ IC NSAL+SSSFLFAKLPEAYAFLNPIVD MPVIPVLFFLLAFVWQAAVSFR
Sbjct:    1 MLNIFNLICICFNSALFSSSFLFAKLPEAYAFLNPIVDFMPVIPVLFFLLAFVWQAAVSFR 61          
BLAST of DR404003 vs. ExPASy Swiss-Prot
Match: PSBK_COFAR (Photosystem II reaction center protein K OS=Coffea arabica GN=psbK PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.537e-24
Identity = 53/61 (86.89%), Postives = 56/61 (91.80%), Query Frame = 2
Query:  182 MLNIFSLMYICLNSALYSSSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 364
            MLNIFSL++ICLNSALYSS F F KLPEAYAFLNPI+D MPVIPV FFLLAFVWQAAVSFR
Sbjct:    1 MLNIFSLIWICLNSALYSSGFFFGKLPEAYAFLNPIIDFMPVIPVFFFLLAFVWQAAVSFR 61          
BLAST of DR404003 vs. ExPASy Swiss-Prot
Match: PSBK_PHAAO (Photosystem II reaction center protein K OS=Phalaenopsis aphrodite subsp. formosana GN=psbK PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.008e-24
Identity = 53/61 (86.89%), Postives = 56/61 (91.80%), Query Frame = 2
Query:  182 MLNIFSLMYICLNSALYSSSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 364
            MLNIF L+ ICLNS LYSSSF FAKLPEAYAF NPI+DVMP+IPVLFFLLAFVWQAAVSFR
Sbjct:    1 MLNIFCLICICLNSTLYSSSFFFAKLPEAYAFFNPIIDVMPIIPVLFFLLAFVWQAAVSFR 61          
BLAST of DR404003 vs. ExPASy Swiss-Prot
Match: PSBK_PANGI (Photosystem II reaction center protein K OS=Panax ginseng GN=psbK PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 2.623e-24
Identity = 54/61 (88.52%), Postives = 57/61 (93.44%), Query Frame = 2
Query:  182 MLNIFSLMYICLNSALYSSSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 364
            MLNIFSL+ ICLNSALYSSS  FAKLPEAYAFLNPIVD+MPVIP+ FFLLAFVWQAAVSFR
Sbjct:    1 MLNIFSLICICLNSALYSSSLFFAKLPEAYAFLNPIVDLMPVIPLFFFLLAFVWQAAVSFR 61          
BLAST of DR404003 vs. ExPASy Swiss-Prot
Match: PSBK_LIRTU (Photosystem II reaction center protein K OS=Liriodendron tulipifera GN=psbK PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 3.425e-24
Identity = 54/61 (88.52%), Postives = 57/61 (93.44%), Query Frame = 2
Query:  182 MLNIFSLMYICLNSALYSSSFLFAKLPEAYAFLNPIVDVMPVIPVLFFLLAFVWQAAVSFR 364
            MLNIFSL+ IC+NSAL+SSSF FAKLPEAYAF NPIVDVMPVIPVLFFLLA VWQAAVSFR
Sbjct:    1 MLNIFSLICICINSALHSSSFFFAKLPEAYAFFNPIVDVMPVIPVLFFLLALVWQAAVSFR 61          
The following BLAST results are available for this feature:
BLAST of DR404003 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
PSBK_CITSI3.910e-28100.00Photosystem II reaction center protein K OS=Citrus... [more]
PSBK_JASNU3.098e-2591.80Photosystem II reaction center protein K OS=Jasmin... [more]
PSBK_VITVI5.284e-2590.16Photosystem II reaction center protein K OS=Vitis ... [more]
PSBK_MORIN6.901e-2591.80Photosystem II reaction center protein K OS=Morus ... [more]
PSBK_GOSHI9.013e-2590.16Photosystem II reaction center protein K OS=Gossyp... [more]
PSBK_GOSBA9.013e-2590.16Photosystem II reaction center protein K OS=Gossyp... [more]
PSBK_COFAR1.537e-2486.89Photosystem II reaction center protein K OS=Coffea... [more]
PSBK_PHAAO2.008e-2486.89Photosystem II reaction center protein K OS=Phalae... [more]
PSBK_PANGI2.623e-2488.52Photosystem II reaction center protein K OS=Panax ... [more]
PSBK_LIRTU3.425e-2488.52Photosystem II reaction center protein K OS=Liriod... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCSAH-PNP1246P14 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone CSAH-PNP1246P14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR404003 ID=DR404003|Name=DR404003|organism=Citrus sinensis|type=EST|length=422bp
GGGGAAAAGTATGATTTCTTCAATTCTCACACGAGAATAGAAGGATTTTT
GTTTTGATTGGGTCGGTTCCAAGAAGTTTTTTTTGTCTACCTTACTTTCT
TTTCTTCATTTTTATCTTATATCAATAAGATATTAATAACTCAATCAAAA
TAAAATTATCTCCAAGAACAAAATGTTTGTTATGCTTAATATCTTTAGTT
TAATGTATATCTGTCTTAATTCTGCCCTTTATTCGAGTAGTTTTTTATTC
GCTAAATTACCCGAGGCCTACGCTTTTTTGAATCCAATTGTAGATGTTAT
GCCAGTAATACCTGTTCTATTTTTTCTCTTAGCCTTTGTTTGGCAAGCTG
CTGTAAGTTTTCGATAAGATCTTTAATATTGTGCTAGAAAAATTCATGAT
TTATTCTAGTTCGAAAAAAAAA
back to top