DR404002

Overview
NameDR404002
Unique NameDR404002
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length670
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DR404002_ssr186 microsatellite DR404002_ssr186:186..197. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DR404002 vs. ExPASy Swiss-Prot
Match: GID2_ARATH (F-box protein GID2 OS=Arabidopsis thaliana GN=GID2 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.368e-36
Identity = 78/131 (59.54%), Postives = 95/131 (72.52%), Query Frame = 3
Query:  234 GFTNLDENLLFEVLKHADARTLARAACVNKFWHKTAQDE*LWELICTRHFANVGCATQ*LRSVVLALGGFRRLHSLYLHQLPRLPPGAPPSSSK*NPLPRVMGPKTPAHWGRDEVHLSLSLLSVRYHEMMT 626
            GF+NLDENL++EVLKH DA+TLA ++CV+K WHKTAQDE LWELICTRH+ N+GC    LRSVVLALGGFRRLHSLYL  L +             P PR       A +G+DE+ L+LSLLS+RY+E M+
Sbjct:   31 GFSNLDENLVYEVLKHVDAKTLAMSSCVSKIWHKTAQDERLWELICTRHWTNIGCGQNQLRSVVLALGGFRRLHSLYLWPLSK-------------PNPR-------ARFGKDELKLTLSLLSIRYYEKMS 141          
BLAST of DR404002 vs. ExPASy Swiss-Prot
Match: GID2_ORYSJ (F-box protein GID2 OS=Oryza sativa subsp. japonica GN=GID2 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.592e-24
Identity = 59/127 (46.46%), Postives = 82/127 (64.57%), Query Frame = 3
Query:  243 NLDENLLFEVLKHADARTLARAACVNKFWHKTAQDE*LWELICTRHFANVGCATQ*LRSVVLALGGFRRLHSLYLHQLPRLPPGAPPSSSK*NPLPRVMGPKTPAHWGRDEVHLSLSLLSVRYHEMM 623
            +L E+L+FEVL+ A+ARTLA AACV++ W + A+DE LWE  C R +AN+G + + LR+VVL+LGGFRRLH++Y+  L     G P    +  P         P   GRD+V LSLSL S+ + + M
Sbjct:   75 DLGEDLVFEVLRRAEARTLAAAACVSRGWRQLAEDERLWEAACVREWANLGFSERQLRAVVLSLGGFRRLHAVYIRPLQWRGAGVPRQQGRRQP---------PVRLGRDQVQLSLSLFSIGFFQNM 192          
The following BLAST results are available for this feature:
BLAST of DR404002 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
GID2_ARATH2.368e-3659.54F-box protein GID2 OS=Arabidopsis thaliana GN=GID2... [more]
GID2_ORYSJ1.592e-2446.46F-box protein GID2 OS=Oryza sativa subsp. japonica... [more]
back to top
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCSAH-PNP1246P13 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone CSAH-PNP1246P13 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR404002 ID=DR404002|Name=DR404002|organism=Citrus sinensis|type=EST|length=670bp
GGGGATATNNACTTACTTGAACATTTATAATGGCTTCTCATTTGAAAGCT
GTTTAAAAATTAACCATGACAGATGAGATGCATAAATCATTATGCAAGTA
TAGTAAAAAGCACCCCCCACATGCTAGCACAAAGAATTGCAGCAGTGAGT
TTTTGAAAATTTTCACTTGGAAGTTAGTCAAACAAGAGGAGGAGGAGGTG
GAGGAGGAAGAGGGAGAGCAATCCGAAGAAACTGGCTTCACAAATCTGGA
CGAGAACCTTCTGTTCGAGGTGTTGAAACACGCGGACGCCAGGACTTTGG
CGCGGGCGGCCTGCGTCAACAAGTTCTGGCACAAGACGGCTCAAGACGAG
TGACTCTGGGAGTTGATCTGCACCCGCCACTTCGCTAACGTTGGGTGTGC
TACCCAATAGCTGAGATCCGTGGTCCTGGCTCTCGGTGGCTTCCGTCGCC
TTCACTCCCTCTACCTCCACCAGCTTCCCAGGCTGCCACCCGGCGCTCCG
CCTTCTTCCTCCAAGTAGAATCCTCTCCCGCGCGTCATGGGCCCCAAGAC
CCCGGCCCACTGGGGGAGAGACGAGGTCCATCTCTCCTTGTCTCTGCTTT
CCGTCCGTTACCATGAGATGATGACTATTAGGGATCTAACCAAGCAATGA
TATATGTACTCCTTCCTCAT
back to top