CX069719
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX069719 vs. ExPASy Swiss-Prot
Match: PETD_SOLLC (Cytochrome b6-f complex subunit 4 OS=Solanum lycopersicum GN=petD PE=3 SV=1) HSP 1 Score: 100.908 bits (250), Expect = 8.887e-21 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 1 Query: 676 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 813 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI Sbjct: 3 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 48
BLAST of CX069719 vs. ExPASy Swiss-Prot
Match: PETD_SOLBU (Cytochrome b6-f complex subunit 4 OS=Solanum bulbocastanum GN=petD PE=3 SV=1) HSP 1 Score: 100.908 bits (250), Expect = 8.887e-21 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 1 Query: 676 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 813 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI Sbjct: 3 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 48
BLAST of CX069719 vs. ExPASy Swiss-Prot
Match: PETD_PIPCE (Cytochrome b6-f complex subunit 4 OS=Piper cenocladum GN=petD PE=3 SV=1) HSP 1 Score: 100.908 bits (250), Expect = 8.887e-21 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 1 Query: 676 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 813 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI Sbjct: 3 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 48
BLAST of CX069719 vs. ExPASy Swiss-Prot
Match: PETD_DRIGR (Cytochrome b6-f complex subunit 4 OS=Drimys granadensis GN=petD PE=3 SV=1) HSP 1 Score: 100.908 bits (250), Expect = 8.887e-21 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 1 Query: 676 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 813 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI Sbjct: 3 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 48
BLAST of CX069719 vs. ExPASy Swiss-Prot
Match: PETD_WHEAT (Cytochrome b6-f complex subunit 4 OS=Triticum aestivum GN=petD PE=3 SV=3) HSP 1 Score: 100.523 bits (249), Expect = 1.161e-20 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 1 Query: 676 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 813 +TKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI Sbjct: 3 VTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 48
BLAST of CX069719 vs. ExPASy Swiss-Prot
Match: PETD_VITVI (Cytochrome b6-f complex subunit 4 OS=Vitis vinifera GN=petD PE=3 SV=1) HSP 1 Score: 100.523 bits (249), Expect = 1.161e-20 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 1 Query: 676 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 813 +TKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI Sbjct: 3 VTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 48
BLAST of CX069719 vs. ExPASy Swiss-Prot
Match: PETD_TOBAC (Cytochrome b6-f complex subunit 4 OS=Nicotiana tabacum GN=petD PE=3 SV=2) HSP 1 Score: 100.523 bits (249), Expect = 1.161e-20 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 1 Query: 676 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 813 +TKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI Sbjct: 3 VTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 48
BLAST of CX069719 vs. ExPASy Swiss-Prot
Match: PETD_SPIOL (Cytochrome b6-f complex subunit 4 OS=Spinacia oleracea GN=petD PE=1 SV=2) HSP 1 Score: 100.523 bits (249), Expect = 1.161e-20 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 1 Query: 676 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 813 +TKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI Sbjct: 3 VTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 48
BLAST of CX069719 vs. ExPASy Swiss-Prot
Match: PETD_SOYBN (Cytochrome b6-f complex subunit 4 OS=Glycine max GN=petD PE=3 SV=1) HSP 1 Score: 100.523 bits (249), Expect = 1.161e-20 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 1 Query: 676 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 813 +TKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI Sbjct: 3 VTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 48
BLAST of CX069719 vs. ExPASy Swiss-Prot
Match: PETD_SORBI (Cytochrome b6-f complex subunit 4 OS=Sorghum bicolor GN=petD PE=3 SV=1) HSP 1 Score: 100.523 bits (249), Expect = 1.161e-20 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 1 Query: 676 ITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 813 +TKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI Sbjct: 3 VTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTI 48 The following BLAST results are available for this feature:
BLAST of CX069719 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 126
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX069719 ID=CX069719; Name=CX069719; organism=Citrus sinensis; type=EST; length=814bpback to top |