DR403994

Overview
NameDR403994
Unique NameDR403994
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length700
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DR403994 vs. ExPASy Swiss-Prot
Match: SUVR4_ARATH (Histone-lysine N-methyltransferase SUVR4 OS=Arabidopsis thaliana GN=SUVR4 PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 2.677e-24
Identity = 33/42 (78.57%), Postives = 37/42 (88.10%), Query Frame = 1
Query:   67 NCRCFDANLIDIPVEIETPDRHYYHLAFFTTRDVSASEELTW 192
            N RC DAN+IDIP+EIETPDRHYYH+AFFT RDV A +ELTW
Sbjct:  391 NHRCEDANMIDIPIEIETPDRHYYHIAFFTLRDVKAMDELTW 432          

HSP 2 Score: 53.5286 bits (127), Expect = 2.677e-24
Identity = 21/29 (72.41%), Postives = 23/29 (79.31%), Query Frame = 3
Query:  291 DYGIDFSDHDHPIKAFHCCCGSEFCRDVK 377
            DY IDF+D  HP+KAF CCCGSE CRD K
Sbjct:  433 DYMIDFNDKSHPVKAFRCCCGSESCRDRK 461          
BLAST of DR403994 vs. ExPASy Swiss-Prot
Match: SUVR1_ARATH (Histone-lysine N-methyltransferase SUVR1 OS=Arabidopsis thaliana GN=SUVR1 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.731e-22
Identity = 32/42 (76.19%), Postives = 37/42 (88.10%), Query Frame = 1
Query:   67 NCRCFDANLIDIPVEIETPDRHYYHLAFFTTRDVSASEELTW 192
            N RC DANLI+IPV++ETPD+HYYHLAFFTTRD+ A EEL W
Sbjct:  548 NHRCLDANLIEIPVQVETPDQHYYHLAFFTTRDIEAMEELAW 589          

HSP 2 Score: 45.4394 bits (106), Expect = 8.731e-22
Identity = 18/29 (62.07%), Postives = 22/29 (75.86%), Query Frame = 3
Query:  291 DYGIDFSDHDHPIKAFHCCCGSEFCRDVK 377
            DYGIDF+D+D  +K F C CGS FCR+ K
Sbjct:  590 DYGIDFNDNDSLMKPFDCLCGSRFCRNKK 618          
BLAST of DR403994 vs. ExPASy Swiss-Prot
Match: SUVR2_ARATH (Histone-lysine N-methyltransferase SUVR2 OS=Arabidopsis thaliana GN=SUVR2 PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.179e-12
Identity = 42/86 (48.84%), Postives = 48/86 (55.81%), Query Frame = 1
Query:   67 NCRCFDANLIDIPVEIETPDRHYYHLAFFTTRDVSASEELTWLIKNNSKIELKFGDKINQHF-----AHCRDGLDDINCRTMESIS 309
            N RC DANLI+IPV  ET D HYYHLAFFTTR++ A EELTW           +G   NQ        HC+ G D   CR  + IS
Sbjct:  635 NHRCLDANLIEIPVHAETTDSHYYHLAFFTTREIDAMEELTW----------DYGVPFNQDVFPTSPFHCQCGSD--FCRVRKQIS 708          
The following BLAST results are available for this feature:
BLAST of DR403994 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
SUVR4_ARATH2.677e-2478.57Histone-lysine N-methyltransferase SUVR4 OS=Arabid... [more]
SUVR1_ARATH8.731e-2276.19Histone-lysine N-methyltransferase SUVR1 OS=Arabid... [more]
SUVR2_ARATH1.179e-1248.84Histone-lysine N-methyltransferase SUVR2 OS=Arabid... [more]
back to top
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCSAH-PNP1246P03 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone CSAH-PNP1246P03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403994 ID=DR403994|Name=DR403994|organism=Citrus sinensis|type=EST|length=700bp
GGGGGAGAAAATGTGGCTGCTGCATGCAGTGTCAAAATCGAATTGTACAG
CAAGNNATTACATGCAAATTGCAGATGCTTTGATGCAAACCTGATTGATA
TACCGGTTGAAATAGAGACCCCTGATCGCCACTACTATCATCTTGCTTTT
TTTACAACAAGGGATGTGAGTGCTTCTGAAGAGCTGACCTGGCTGATTAA
GAACAACTCAAAAATTGAGTTGAAATTTGGTGACAAAATTAATCAACATT
TTGCTCATTGTCGTGATGGTTTGGATGACATTAACTGTAGGACTATGGAA
TCGATTTCAGTGATCATGATCATCCTATAAAAGCATTTCATTGTTGTTGC
GGAAGTGAATTTTGCCGAGACGTGAAGTAAAGAGTTCGTGTATCTCATCT
ACGATAGTGAAGGTAAAGGATTTTTTTCTTTATTTTATTAGAAATTTTCC
CTCTGGTTCCNTGCTACTGCAGGACTATGGAATTGACCTCAGTGATCATG
TTCTGCATGTTTCAGTTTCCTTATCCCCTTGGTTGTGGCTAACTGTTATC
ATTATTTGCTACTACCGGAATTTAGTTGACTTTTCTGTAGTGCTTGGATG
AACTTTGACTGGTGAGGAAGTAATATTAAGCATTGACTGTTCTTGTGAAA
AAAAAAAAAAAAAAAAAAAAAAAGAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top