DR403993

Overview
NameDR403993
Unique NameDR403993
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length582
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig557 contig Csv1_Contig557:308..892. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403993 vs. ExPASy Swiss-Prot
Match: CHIT_CARPA (Endochitinase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 2.934e-71
Identity = 122/195 (62.56%), Postives = 146/195 (74.87%), Query Frame = 2
Query:    5 YRNDELCPAKGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGRETTGGWPDAPGGEYAWGYCFISEVSPPSDYC--DPNYPCR-GK-YYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGN 577
            +RN+  CPAKGFYTYDAF+ AA++FP FG +G+  +RKRE+AAF  QT  ETTGGWP AP G YAWGYCF+ E +P S+YC   P YPC  GK YYGRGP+QLSWNYNY  C            NPDL+ATD VLSFK+A+WFWMT Q PKPSCH+V+   W+PSA D  AGRLPGYG+ TN++NGG+ECG+G N
Sbjct:   17 HRNNPACPAKGFYTYDAFLAAAKSFPSFGTTGSTDVRKRELAAFLGQTSHETTGGWPSAPDGPYAWGYCFLKERNPSSNYCAPSPRYPCAPGKSYYGRGPLQLSWNYNYGPC--GEALRVNLLGNPDLVATDRVLSFKTALWFWMTPQAPKPSCHDVLTGRWQPSAADTAAGRLPGYGVLTNLLNGGLECGKGPN 209          
BLAST of DR403993 vs. ExPASy Swiss-Prot
Match: CHIB_ARATH (Basic endochitinase B OS=Arabidopsis thaliana GN=CHI-B PE=1 SV=3)

HSP 1 Score: 267.7 bits (683), Expect = 2.934e-71
Identity = 121/193 (62.69%), Postives = 146/193 (75.65%), Query Frame = 2
Query:    5 YRNDELCPAKGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGRETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQG 571
            +RND  CPA+GFYTY+AFI AA++FPGFG +G+   RK+E+AAFF QT  ETTGGW  AP G Y+WGYCF  E +P SDYC+P+  +PC    +YYGRGP+QLSWNYNY  C           NNPDL+A D V++FK+AIWFWMTAQPPKPSCH VI  +W+PS  D  AGRLPGYG+ TNIINGG+ECG+G
Sbjct:  101 HRNDAACPARGFYTYNAFITAAKSFPGFGTTGDTATRKKEVAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPASDYCEPSATWPCASGKRYYGRGPMQLSWNYNYGLC--GRAIGVDLLNNPDLVANDAVIAFKAAIWFWMTAQPPKPSCHAVIAGQWQPSDADRAAGRLPGYGVITNIINGGLECGRG 291          
BLAST of DR403993 vs. ExPASy Swiss-Prot
Match: CHI2_BRANA (Endochitinase CH25 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 5.005e-71
Identity = 120/196 (61.22%), Postives = 147/196 (75.00%), Query Frame = 2
Query:    5 YRNDELCPAKGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGRETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCRG--KYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNA 580
            +RND  CPA+GFYTYDAFI AA++FPGFG +G+   RK+EIAAFF QT  ETTGGW  AP G Y+WGYCF  E +P S+YC P+  +PC     YYGRGP+QLSWNYNY +C           NNPDL++ DPV++FK+AIWFWMT Q PKPSCH VI+ +W+PS  D  AGR+PGYG+ TNIINGG+ECG+G +A
Sbjct:   86 HRNDNACPARGFYTYDAFINAAKSFPGFGTTGDTATRKKEIAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPSSNYCSPSAEWPCASGKSYYGRGPMQLSWNYNYGQC--GRAIGSDLLNNPDLVSNDPVIAFKAAIWFWMTPQSPKPSCHAVIVGQWQPSDADRAAGRVPGYGVITNIINGGLECGRGQDA 279          
BLAST of DR403993 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.115e-70
Identity = 127/198 (64.14%), Postives = 149/198 (75.25%), Query Frame = 2
Query:    5 YRNDELCPAKGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGRETTGG--WPDAPGGEYAWGYCFISEVSPPSDYC--DPNYPCR-GK-YYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNA 580
            +RND  CPA+GFYTYDAFI AA++FP F  +G++  RKREIAAF AQT  ETTGG  W  AP G YAWGYC+  E++PPS YC  DPNYPC  GK Y+GRGP+QLSWNYNY +C           NNPDLL++DP +SFKSA WFWMT Q PKPSCH VII  W PS++D  AGR+PGYG+ TNIINGG+ECG+G NA
Sbjct:   89 HRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSSYCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAIGVDLL--NNPDLLSSDPTISFKSAFWFWMTPQSPKPSCHNVIIGAWSPSSSDRAAGRVPGYGVITNIINGGLECGKGWNA 283          
BLAST of DR403993 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 264.618 bits (675), Expect = 2.484e-70
Identity = 123/193 (63.73%), Postives = 144/193 (74.61%), Query Frame = 2
Query:    5 YRNDELCPAKGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGRETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCR--GKYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQG 571
            +RND  C  KGFY+Y+AFI AA++FPGFG SG+ T RKREIAAFFAQT  ETTGGW  AP G YAWGYC++ E   P DYC P+  +PC    KY+GRGPIQ+S NYNY  C           NNPDL+ATDPV+SFKSA+WFWMT Q PKPSCH+VII  W+PSA D  A RLPG+G+ TNIINGG+ECG+G
Sbjct:   95 HRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPC--GRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSAGDRAANRLPGFGVITNIINGGLECGRG 285          
BLAST of DR403993 vs. ExPASy Swiss-Prot
Match: CHI2_TOBAC (Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 9.439e-70
Identity = 122/193 (63.21%), Postives = 144/193 (74.61%), Query Frame = 2
Query:    5 YRNDELCPAKGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGRETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDPN--YPCR--GKYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQG 571
            +RND  C  KGFY+Y+AFI AA++FPGFG SG+ T RKREIAAFFAQT  ETTGGW  AP G YAWGYC++ E   P DYC P+  +PC    KY+GRGPIQ+S NYNY  C           NNPDL+ATDPV+SFKSA+WFWMT Q PKPSCH+VII  W+PS+ D  A RLPG+G+ TNIINGG+ECG+G
Sbjct:   90 HRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAPGRKYFGRGPIQISHNYNYGPC--GRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSSADRAANRLPGFGVITNIINGGLECGRG 280          
BLAST of DR403993 vs. ExPASy Swiss-Prot
Match: CHI2_GOSHI (Endochitinase 2 (Fragment) OS=Gossypium hirsutum PE=2 SV=2)

HSP 1 Score: 261.922 bits (668), Expect = 1.610e-69
Identity = 126/198 (63.64%), Postives = 147/198 (74.24%), Query Frame = 2
Query:    5 YRNDELCPAKGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGRETTGG--WPDAPGGEYAWGYCFISEVSPPSDYC--DPNYPCR-GK-YYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNA 580
            +RND  CPA+GFYTYDAFI AA++FP F  +G++  RKREIAAF AQT  ETTGG  W  AP G YAWGYC+  E++PPS YC  DPNYPC  GK Y+GRGP+QLSWNYNY +C           NNPDLL++DP +SFKSA WFWMT Q PKPSCH VII  W PS++D  AGR  GYG+ TNIINGG+ECG+G NA
Sbjct:   67 HRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSSYCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAIGVDLL--NNPDLLSSDPTISFKSAFWFWMTPQSPKPSCHNVIIGAWSPSSSDRAAGRATGYGVITNIINGGLECGKGWNA 261          
BLAST of DR403993 vs. ExPASy Swiss-Prot
Match: CHI6_POPTR (Acidic endochitinase WIN6 OS=Populus trichocarpa GN=WIN6 PE=2 SV=2)

HSP 1 Score: 261.536 bits (667), Expect = 2.103e-69
Identity = 125/194 (64.43%), Postives = 142/194 (73.20%), Query Frame = 2
Query:    5 YRNDELCPAKGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGRETTGGWPDAPGGEYAWGYCFISEVSPPSDYCDP--NYPC-RGKYY-GRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGG 574
            +RND  CPA GFYTY+AFI AA+ FP FGN+G++ MRKREIAAF  QT  ETTGGWPDAP G YAWGYC++ E++    YCDP  NY C  GK Y GRGPIQLSWNYNY  C             P+L+ TDPV+SFK+AIWFWM  Q PKPSCH VI   W PSA D+ AGR+PGYG+ TNIINGGIECGQGG
Sbjct:  104 FRNDARCPAAGFYTYNAFISAAKEFPDFGNTGDDLMRKREIAAFLGQTSHETTGGWPDAPCGPYAWGYCYLKEIN-CQPYCDPSSNYQCVAGKQYCGRGPIQLSWNYNYGLC--GDDLKLPLLQEPELVETDPVISFKTAIWFWMKPQSPKPSCHAVITGNWTPSAADLEAGRVPGYGVITNIINGGIECGQGG 294          
BLAST of DR403993 vs. ExPASy Swiss-Prot
Match: CHI1_THECC (Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 6.118e-69
Identity = 126/198 (63.64%), Postives = 148/198 (74.75%), Query Frame = 2
Query:    5 YRNDELCPAKGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGRETTGG--WPDAPGGEYAWGYCFISEVSPPSDYC--DPNYPCR-GK-YYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNA 580
            +RND  CPA+GFYTYDAFI AA++FP F  +G++  RKRE+AAF AQT  ETTGG  W  AP G Y WGYC+  E++P +DYC  DPNYPC  GK Y+GRGP+QL+WNYNY +C           NNPDLLATDP +SFKSA WFWMT Q PKPSCH+VII  W PS +D  AGR+PG+GL TNIINGG+ECGQG NA
Sbjct:   87 HRNDGGCPARGFYTYDAFIAAAKSFPAFATTGDDATRKREVAAFLAQTSHETTGGAGWA-APDGPYTWGYCYNRELNP-ADYCQWDPNYPCAPGKQYFGRGPMQLTWNYNYGQCGRAIGVDLL--NNPDLLATDPTISFKSAFWFWMTPQSPKPSCHDVIIGAWSPSGSDQAAGRVPGFGLITNIINGGLECGQGWNA 280          
BLAST of DR403993 vs. ExPASy Swiss-Prot
Match: CHIT_PHAVU (Endochitinase OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 7.990e-69
Identity = 123/193 (63.73%), Postives = 141/193 (73.06%), Query Frame = 2
Query:    5 YRNDELCPAKGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQTGRETTGGWPDAPGGEYAWGYCFISEVSPPSDYCD--PNYPCR--GKYYGRGPIQLSWNYNYLRCXXXXXXXXXXXNNPDLLATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQG 571
            +RND  CPAKGFYTYDAFI AA+A+P FGN+G+   RKREIAAF  QT  ETTGGW  AP G YAWGYCF+ E + PS YC   P +PC    +YYGRGPIQ+SWNYNY +C           N PDL+ATD V+SFKSA+WFWMTAQ PKPS H+VI   W PS+ DV A RLPGYG  TNIINGG+ECG+G
Sbjct:   91 HRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERN-PSTYCSATPQFPCAPGQQYYGRGPIQISWNYNYGQC--GRAIGVDLLNKPDLVATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSADVAARRLPGYGTVTNIINGGLECGRG 280          
The following BLAST results are available for this feature:
BLAST of DR403993 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHIT_CARPA2.934e-7162.56Endochitinase OS=Carica papaya PE=1 SV=1[more]
CHIB_ARATH2.934e-7162.69Basic endochitinase B OS=Arabidopsis thaliana GN=C... [more]
CHI2_BRANA5.005e-7161.22Endochitinase CH25 OS=Brassica napus PE=2 SV=1[more]
CHI1_GOSHI1.115e-7064.14Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHI1_TOBAC2.484e-7063.73Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]
CHI2_TOBAC9.439e-7063.21Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1... [more]
CHI2_GOSHI1.610e-6963.64Endochitinase 2 (Fragment) OS=Gossypium hirsutum P... [more]
CHI6_POPTR2.103e-6964.43Acidic endochitinase WIN6 OS=Populus trichocarpa G... [more]
CHI1_THECC6.118e-6963.64Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 S... [more]
CHIT_PHAVU7.990e-6963.73Endochitinase OS=Phaseolus vulgaris PE=1 SV=1[more]

Pages

back to top
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCSAH-PNP1246P02 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone CSAH-PNP1246P02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403993 ID=DR403993|Name=DR403993|organism=Citrus sinensis|type=EST|length=582bp
GGGGTATAGAAATGATGAACTATGCCCTGCCAAAGGCTTCTACACTTATG
ATGCTTTTATAGAGGCAGCCCAAGCTTTTCCAGGCTTTGGTAACTCTGGA
AATGAAACCATGCGTAAAAGAGAAATCGCTGCCTTTTTTGCCCAAACTGG
CCGTGAAACTACTGGGGGATGGCCCGATGCACCTGGTGGCGAATATGCTT
GGGGATATTGCTTTATAAGCGAAGTTAGCCCTCCGTCCGACTACTGTGAT
CCTAACTATCCATGTCGAGGGAAGTACTATGGCCGAGGTCCAATTCAACT
CTCTTGGAATTACAATTACTTACGGTGCGGAGAAGGCCTAGGGCTAGGAG
AGGAGTTGTTGAACAATCCAGACCTTCTTGCTACTGATCCAGTACTATCA
TTCAAGTCAGCAATCTGGTTCTGGATGACTGCACAGCCACCAAAGCCATC
GTGCCACGAAGTCATTATCGACGAATGGAAACCATCAGCAAATGACGTAA
ACGCCGGCCGGCTTCCGGGATACGGTCTAACCACAAATATAATCAACGGT
GGAATTGAATGTGGCCAAGGTGGGAATGCCGC
back to top