DR403992

Overview
NameDR403992
Unique NameDR403992
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length572
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8732 contig Csv1_Contig8732:546..1117. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403992 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 6.673e-44
Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
Query:    4 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 273
            EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  421 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of DR403992 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 6.673e-44
Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
Query:    4 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 273
            EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  421 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of DR403992 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 6.673e-44
Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
Query:    4 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 273
            EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  421 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of DR403992 vs. ExPASy Swiss-Prot
Match: INO1_CITPA (Inositol-3-phosphate synthase OS=Citrus paradisi PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 6.673e-44
Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
Query:    4 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 273
            EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  418 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 507          
BLAST of DR403992 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 3.312e-43
Identity = 88/90 (97.78%), Postives = 89/90 (98.89%), Query Frame = 1
Query:    4 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 273
            EDSLLAAPIILDLVLLAELSTRIQ KAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMI+EYK
Sbjct:  421 EDSLLAAPIILDLVLLAELSTRIQFKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMIMEYK 510          
BLAST of DR403992 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.644e-42
Identity = 88/90 (97.78%), Postives = 88/90 (97.78%), Query Frame = 1
Query:    4 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 273
            EDSLLAAPIILDLVLLAELSTRIQ KAEGEGKFHSFHPVATILSYLTKAPLVP GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  421 EDSLLAAPIILDLVLLAELSTRIQFKAEGEGKFHSFHPVATILSYLTKAPLVPAGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of DR403992 vs. ExPASy Swiss-Prot
Match: INO1_MAIZE (Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 1.644e-42
Identity = 87/90 (96.67%), Postives = 89/90 (98.89%), Query Frame = 1
Query:    4 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 273
            EDSLLAAPIILDLVLLAELSTRIQLKAEGE KFHSFHPVATILSYLTKAPLVPPGTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK
Sbjct:  421 EDSLLAAPIILDLVLLAELSTRIQLKAEGEDKFHSFHPVATILSYLTKAPLVPPGTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510          
BLAST of DR403992 vs. ExPASy Swiss-Prot
Match: INO1_ORYSJ (Inositol-3-phosphate synthase OS=Oryza sativa subsp. japonica GN=INO1 PE=2 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 2.147e-42
Identity = 87/90 (96.67%), Postives = 89/90 (98.89%), Query Frame = 1
Query:    4 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 273
            EDSLLAAPIILDLVLLAELSTRIQLKAEGE KFHSFHPVATILSYLTKAPLVPPGTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK
Sbjct:  421 EDSLLAAPIILDLVLLAELSTRIQLKAEGEEKFHSFHPVATILSYLTKAPLVPPGTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510          
BLAST of DR403992 vs. ExPASy Swiss-Prot
Match: INO1_SPIPO (Inositol-3-phosphate synthase OS=Spirodela polyrrhiza GN=TUR1 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 2.804e-42
Identity = 87/90 (96.67%), Postives = 89/90 (98.89%), Query Frame = 1
Query:    4 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 273
            EDSLLAAPIILDLVLLAELSTRIQLKAEGE KFHSFHPVA+ILSYL+KAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  421 EDSLLAAPIILDLVLLAELSTRIQLKAEGESKFHSFHPVASILSYLSKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of DR403992 vs. ExPASy Swiss-Prot
Match: INO1_MESCR (Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 3.662e-42
Identity = 88/90 (97.78%), Postives = 88/90 (97.78%), Query Frame = 1
Query:    4 EDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 273
            EDSLLAAPIILDLVLLAELSTRIQLKAE E KFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  423 EDSLLAAPIILDLVLLAELSTRIQLKAEEEDKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 512          
The following BLAST results are available for this feature:
BLAST of DR403992 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
INO1_TOBAC6.673e-44100.00Inositol-3-phosphate synthase OS=Nicotiana tabacum... [more]
INO1_SESIN6.673e-44100.00Inositol-3-phosphate synthase OS=Sesamum indicum P... [more]
INO1_NICPA6.673e-44100.00Inositol-3-phosphate synthase OS=Nicotiana panicul... [more]
INO1_CITPA6.673e-44100.00Inositol-3-phosphate synthase OS=Citrus paradisi P... [more]
INO2_ARATH3.312e-4397.78Inositol-3-phosphate synthase isozyme 2 OS=Arabido... [more]
INO1_WHEAT1.644e-4297.78Inositol-3-phosphate synthase OS=Triticum aestivum... [more]
INO1_MAIZE1.644e-4296.67Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=... [more]
INO1_ORYSJ2.147e-4296.67Inositol-3-phosphate synthase OS=Oryza sativa subs... [more]
INO1_SPIPO2.804e-4296.67Inositol-3-phosphate synthase OS=Spirodela polyrrh... [more]
INO1_MESCR3.662e-4297.78Inositol-3-phosphate synthase OS=Mesembryanthemum ... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCSAH-PNP1246O23 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone CSAH-PNP1246O23 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403992 ID=DR403992|Name=DR403992|organism=Citrus sinensis|type=EST|length=572bp
GGGGAGGACTCTCTTTTGGCTGCTCCAATCATTCTAGATTTGGTTCTGCT
GGCTGAACTCAGCACCAGGATCCAGCTCAAAGCTGAAGGAGAGGGAAAAT
TCCACTCTTTCCACCCTGTGGCTACAATTCTCAGCTACCTCACCAAGGCT
CCTCTGGTCCCTCCAGGCACACCAGTGGTGAATGCGCTGTCGAAGCAGCG
TGCAATGCTTGAGAACATTCTGAGGGCTTGCGTTGGCTTGGCTCCTGAGA
ACAACATGATTTTGGAATACAAGTGAAGAACTTGCAGGGGAGAAAAGTGG
AAGAACCGGTATTCCCTTTCTCTGTCACCAATCAAAGCTGTGGTGGTCCA
TTTAATTACTGATTGTAATGTCTTGTGTCATGAAATTGTGGTTAATATTA
GTGTCCTGTATGTTTGCTCTTTTATTTTTTTAATGAAGGTGCTGGAGTGT
AGCCCATTGCCTTTGTAGCTCATTTCGGAGCATGCAATCTCTTGTATTGC
AAGTAGATAATATATGGAAGTTCATAAATAACTGTATTGCGGTAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA
back to top