DR403988

Overview
NameDR403988
Unique NameDR403988
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length736
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1234 contig Csv1_Contig1234:147..881. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403988 vs. ExPASy Swiss-Prot
Match: METK1_POPTR (S-adenosylmethionine synthetase 1 OS=Populus trichocarpa GN=METK1 PE=2 SV=1)

HSP 1 Score: 417.542 bits (1072), Expect = 3.617e-116
Identity = 200/211 (94.79%), Postives = 206/211 (97.63%), Query Frame = 1
Query:  103 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK 735
            METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDP+SKVACETCTKTNMVMVFGEITTK K+DYEKIVRDTCR+IGF+SDDVGLDAD CKVLVNIEQQSPDIAQGVHGHFTKRPE+IGAGDQGHMFGYATDET E+MPLSHVLATKLGARLTEVRKN TC WLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKGKIDYEKIVRDTCRNIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK 211          
BLAST of DR403988 vs. ExPASy Swiss-Prot
Match: METK2_ARATH (S-adenosylmethionine synthetase 2 OS=Arabidopsis thaliana GN=SAM2 PE=1 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 1.375e-115
Identity = 200/211 (94.79%), Postives = 204/211 (96.68%), Query Frame = 1
Query:  103 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK 735
            METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDP+SKVACETCTKTNMVMVFGEITTKA +DYEKIVRDTCRSIGF+SDDVGLDAD CKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDET E MPLSHVLATK+GARLTEVRKN TC WLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIA DLK
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATIDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGARLTEVRKNGTCRWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIARDLK 211          
BLAST of DR403988 vs. ExPASy Swiss-Prot
Match: METK_BRARP (S-adenosylmethionine synthetase OS=Brassica rapa subsp. pekinensis GN=SAMS PE=2 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 2.345e-115
Identity = 200/211 (94.79%), Postives = 204/211 (96.68%), Query Frame = 1
Query:  103 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK 735
            METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGF+SDDVGLDAD CKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDET E MPLSHVLATK+GA+LTEVRKN TC WLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIA DLK
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNGTCRWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIARDLK 211          
BLAST of DR403988 vs. ExPASy Swiss-Prot
Match: METK5_BRAJU (S-adenosylmethionine synthetase 5 OS=Brassica juncea GN=MSAMS5 PE=2 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 2.345e-115
Identity = 200/211 (94.79%), Postives = 204/211 (96.68%), Query Frame = 1
Query:  103 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK 735
            METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGF+SDDVGLDAD CKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDET E MPLSHVLATK+GA+LTEVRKN TC WLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIA DLK
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNGTCRWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIARDLK 211          
BLAST of DR403988 vs. ExPASy Swiss-Prot
Match: METK1_CATRO (S-adenosylmethionine synthetase 1 OS=Catharanthus roseus GN=SAMS1 PE=1 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 3.062e-115
Identity = 200/211 (94.79%), Postives = 206/211 (97.63%), Query Frame = 1
Query:  103 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK 735
            METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGFVSDDVGLDAD+CKVLVNIEQQSPDIAQGVHGH TKRPE+IGAGDQGHMFGYATDET EFMPLSHVLATKLGARLTEVRKN TC WLRPDGKTQVTVEYYN+NGAMVPVRVHTV+ISTQHDETVTND+IAADLK
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVVISTQHDETVTNDQIAADLK 211          
BLAST of DR403988 vs. ExPASy Swiss-Prot
Match: METK2_CATRO (S-adenosylmethionine synthetase 2 OS=Catharanthus roseus GN=SAMS2 PE=1 SV=1)

HSP 1 Score: 414.075 bits (1063), Expect = 3.999e-115
Identity = 200/211 (94.79%), Postives = 205/211 (97.16%), Query Frame = 1
Query:  103 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK 735
            METFLFTSESVNEGHPDKLCDQISDAVLDACL QDPESKVACETCTKTNMVMVFGEITTKA+VDYEKIVRDTCR+IGFVSDDVGLDAD+CKVLVNIEQQSPDIAQGVHGH TKRPE+IGAGDQGHMFGYATDET E MPLSHVLATKLGARLTEVRKN TC WLRPDGKTQVTVEYYNDNGAMVP+RVHTVLISTQHDETVTNDEIAADLK
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKAQVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNDNGAMVPIRVHTVLISTQHDETVTNDEIAADLK 211          
BLAST of DR403988 vs. ExPASy Swiss-Prot
Match: METK_CARPA (S-adenosylmethionine synthetase OS=Carica papaya GN=SAMS PE=2 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 5.223e-115
Identity = 201/211 (95.26%), Postives = 204/211 (96.68%), Query Frame = 1
Query:  103 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK 735
            METFLFTSESVNEGHPDKLCDQISDAVLDACL QDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGFVSDDVGLDAD CKVLVNIEQQSPDIAQGVHGHFTKRPE+IGAGDQGHMFGYATDET EFMPLSHVLATKLGARLTEVRKN TC WLRPDGKTQVTVEYYN+NGA VPVRVHTVLISTQHDETVTNDEIAADLK
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGARVPVRVHTVLISTQHDETVTNDEIAADLK 211          
BLAST of DR403988 vs. ExPASy Swiss-Prot
Match: METK4_HORVU (S-adenosylmethionine synthetase 4 OS=Hordeum vulgare GN=SAM4 PE=2 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 5.223e-115
Identity = 198/212 (93.40%), Postives = 207/212 (97.64%), Query Frame = 1
Query:  100 KMETFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK 735
            ++ETFLFTSESVNEGHPDKLCDQISDAVLDACL +DP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR IGFVS+DVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPE+IGAGDQGHMFGYATDET EFMPLSHVLATKLGARLTEVRKN+TC WLRPDGKTQVTVEY+NDNGAMVP+RVHTVLISTQHDETVTNDEIAADLK
Sbjct:    3 EVETFLFTSESVNEGHPDKLCDQISDAVLDACLAEDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSNDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNATCPWLRPDGKTQVTVEYHNDNGAMVPIRVHTVLISTQHDETVTNDEIAADLK 214          
BLAST of DR403988 vs. ExPASy Swiss-Prot
Match: METK2_PEA (S-adenosylmethionine synthetase 2 OS=Pisum sativum GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 6.822e-115
Identity = 200/210 (95.24%), Postives = 203/210 (96.67%), Query Frame = 1
Query:  106 ETFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK 735
            ETFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR+IGFVSDDVGLDAD+CKVLVNIEQQSPDIAQGVHGH TKRPEDIGAGDQGHMFGYATDET EFMPLSHVLATKLGA LTEVRKN TC WLRPDGKTQVTVEYYND GAMVP+RVHTVLISTQHDETVTNDEIAADLK
Sbjct:    4 ETFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRNIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEFMPLSHVLATKLGASLTEVRKNGTCPWLRPDGKTQVTVEYYNDKGAMVPIRVHTVLISTQHDETVTNDEIAADLK 213          
BLAST of DR403988 vs. ExPASy Swiss-Prot
Match: METK1_ELAUM (S-adenosylmethionine synthetase 1 OS=Elaeagnus umbellata GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 6.822e-115
Identity = 199/211 (94.31%), Postives = 206/211 (97.63%), Query Frame = 1
Query:  103 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLK 735
            METFLFTSESVNEGHPDKLCDQISDAVLDACL QDP+SKVACETC+KTNMVMVFGEITTKA VDYEKIVRDTCR+IGFVSDDVGLDAD+CKVLVNIEQQSPDIAQGVHGHFTKRPE+IGAGDQGHMFGYATDET E+MPLSHVLATKLGARLTEVRKN TC WLRPDGKTQVTVEYYN+NGAMVPVRVHTVLISTQHDETVTNDEIAADLK
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCSKTNMVMVFGEITTKANVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLK 211          
The following BLAST results are available for this feature:
BLAST of DR403988 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK1_POPTR3.617e-11694.79S-adenosylmethionine synthetase 1 OS=Populus trich... [more]
METK2_ARATH1.375e-11594.79S-adenosylmethionine synthetase 2 OS=Arabidopsis t... [more]
METK_BRARP2.345e-11594.79S-adenosylmethionine synthetase OS=Brassica rapa s... [more]
METK5_BRAJU2.345e-11594.79S-adenosylmethionine synthetase 5 OS=Brassica junc... [more]
METK1_CATRO3.062e-11594.79S-adenosylmethionine synthetase 1 OS=Catharanthus ... [more]
METK2_CATRO3.999e-11594.79S-adenosylmethionine synthetase 2 OS=Catharanthus ... [more]
METK_CARPA5.223e-11595.26S-adenosylmethionine synthetase OS=Carica papaya G... [more]
METK4_HORVU5.223e-11593.40S-adenosylmethionine synthetase 4 OS=Hordeum vulga... [more]
METK2_PEA6.822e-11595.24S-adenosylmethionine synthetase 2 OS=Pisum sativum... [more]
METK1_ELAUM6.822e-11594.31S-adenosylmethionine synthetase 1 OS=Elaeagnus umb... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCSAH-PNP1246O17 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone CSAH-PNP1246O17 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403988 ID=DR403988|Name=DR403988|organism=Citrus sinensis|type=EST|length=736bp
GGGGGCCCAAACTCAATTGAGTTCCGCTTTGCTATTGAGGTCTGGTCTTA
AGTCTGAATCTTAGATCTGCGCCGAAACACTTGCCAGCCACAGCTTGATA
AGATGGAGACCTTTCTATTCACCTCTGAATCTGTGAACGAGGGTCACCCC
GACAAGTTGTGCGACCAGATCTCTGATGCGGTGCTTGACGCCTGCCTTGA
GCAGGATCCTGAGAGCAAGGTTGCCTGTGAGACATGCACCAAGACCAACA
TGGTCATGGTCTTTGGAGAGATTACCACCAAGGCCAAGGTAGACTATGAG
AAGATTGTTCGCGACACTTGCCGTTCCATTGGATTTGTTTCTGATGATGT
GGGTCTTGACGCCGATCACTGCAAAGTCCTGGTCAATATTGAGCAACAAA
GCCCGGATATTGCCCAGGGTGTTCATGGCCACTTTACAAAGCGCCCTGAG
GACATTGGTGCTGGTGACCAGGGCCATATGTTTGGTTATGCTACTGATGA
GACCTCTGAATTTATGCCTTTGAGCCATGTCCTTGCCACCAAACTTGGTG
CTCGTCTCACGGAGGTTAGGAAGAATAGTACCTGCTCTTGGCTAAGGCCC
GATGGGAAGACCCAGGTCACTGTTGAGTACTACAACGACAATGGTGCCAT
GGTCCCAGTCCGTGTCCACACGGTCCTCATTTCAACCCAGCATGATGAGA
CTGTCACAAATGATGAAATTGCTGCTGACCTTAAGG
back to top