DR403986

Overview
NameDR403986
Unique NameDR403986
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length717
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6148 contig Csv1_Contig6148:7..722. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403986 vs. ExPASy Swiss-Prot
Match: CLH1_CITUN (Chlorophyllase-1, chloroplastic OS=Citrus unshiu PE=2 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.291e-54
Identity = 121/229 (52.84%), Postives = 145/229 (63.32%), Query Frame = 1
Query:   40 MTALADSKPV-SVEAKPGLATALLSVFSSGPYSPKLKTVNKPWFNSFPP-KPLNIVYPEEKGTYEVILFFHGTALSNTSYSNLLDHLASHGYIVVAPQLYDFL-PPKGNGEVNDAANVLNWLSTGLQSELPENVEANLNYVALMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSHDSFEFSIPXXXXXXXXXXXXKCMQPCAPENKNH 717
            M A+ DSKP  SV+  P LATA L VF+ G YS K  T+     +S PP KPL IV P EKGT+ VILF HGT+LSN SYS + DH+ASHG+IVVAPQLY  + PP    E+N AA V  WL  GLQ  LPEN EAN++ VA+MGHSRGG  AF L+L Y           A++G+DPVAG  S  + L+P ILS DSF+FSIP            +C+  CAPE  NH
Sbjct:    1 MAAMVDSKPAASVQGTPLLATATLPVFTRGIYSTKRITLETSSPSSPPPPKPLIIVTPAEKGTFNVILFLHGTSLSNKSYSKIFDHIASHGFIVVAPQLYTSIPPPSATNELNSAAEVAEWLPQGLQQNLPENTEANVSLVAVMGHSRGGQTAFALSLRYG--------FGAVIGLDPVAG-TSKTTGLDPSILSFDSFDFSIPVTVIGTGLGGVARCITACAPEGANH 220          
BLAST of DR403986 vs. ExPASy Swiss-Prot
Match: CLH1_CITSI (Chlorophyllase-1, chloroplastic OS=Citrus sinensis GN=CHLASE1 PE=1 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.864e-53
Identity = 119/229 (51.97%), Postives = 144/229 (62.88%), Query Frame = 1
Query:   40 MTALADSKPV-SVEAKPGLATALLSVFSSGPYSPKLKTVNKPWFNSFPP-KPLNIVYPEEKGTYEVILFFHGTALSNTSYSNLLDHLASHGYIVVAPQLYDFL-PPKGNGEVNDAANVLNWLSTGLQSELPENVEANLNYVALMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSHDSFEFSIPXXXXXXXXXXXXKCMQPCAPENKNH 717
            M A+ D+KP  SV+  P LATA L VF+ G YS K  T+     +S PP KPL IV P  KGT+ VILF HGT+LSN SYS + DH+ASHG+IVVAPQLY  + PP    E+N AA V  WL  GLQ  LPEN EAN++ VA+MGHSRGG  AF L+L Y           A++G+DPVAG  S  + L+P ILS DSF+FSIP            +C+  CAPE  NH
Sbjct:    1 MAAMVDAKPAASVQGTPLLATATLPVFTRGIYSTKRITLETSSPSSPPPPKPLIIVTPAGKGTFNVILFLHGTSLSNKSYSKIFDHIASHGFIVVAPQLYTSIPPPSATNELNSAAEVAEWLPQGLQQNLPENTEANVSLVAVMGHSRGGQTAFALSLRYG--------FGAVIGLDPVAG-TSKTTGLDPSILSFDSFDFSIPVTVIGTGLGGVARCITACAPEGANH 220          
BLAST of DR403986 vs. ExPASy Swiss-Prot
Match: CLH1_ARATH (Chlorophyllase-1 OS=Arabidopsis thaliana GN=CLH1 PE=1 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.637e-41
Identity = 91/183 (49.73%), Postives = 116/183 (63.39%), Query Frame = 1
Query:  178 PPKPLNIVYPEEKGTYEVILFFHGTALSNTSYSNLLDHLASHGYIVVAPQLYDFLPPKGNGEVNDAANVLNWLSTGLQSELPENVEANLNYVALMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSH--DSFEFSIP-XXXXXXXXXXXXKCMQPCAPENKNH 717
            PPKP+ I  P   GTY V+LFFHG  L N  YS++L+H+ASHGYI+VAPQL   LPP G  EV+DA +V+NW S  L++ LP +V AN  Y +L+GHSRGG  AF +ALG+A     SI  SAL+GIDPVAG  + +   +P IL++  +SFE  IP               M PCAP + NH
Sbjct:   41 PPKPVRITCPTVAGTYPVVLFFHGFYLRNYFYSDVLNHIASHGYILVAPQLCKLLPPGGQVEVDDAGSVINWASENLKAHLPTSVNANGKYTSLVGHSRGGKTAFAVALGHAATLDPSITFSALIGIDPVAG-TNKYIRTDPHILTYKPESFELDIPVAVVGTGLGPKWNNVMPPCAPTDLNH 222          
BLAST of DR403986 vs. ExPASy Swiss-Prot
Match: CLH0_CHEAL (Chlorophyllase type 0 OS=Chenopodium album GN=CACLH PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 9.955e-31
Identity = 79/188 (42.02%), Postives = 110/188 (58.51%), Query Frame = 1
Query:  103 LLSVFSSGPYSPKLKTVNKPWFNSFPPKPLNIVYPEEKGTYEVILFFHGTALSNTSYSNLLDHLASHGYIVVAPQLYDFLPPK---GNGEVNDAANVLNWLSTGLQSELPE---NVEANLNYVALMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSH--DSFEFSIP 642
            +  VF  G +      +    +    P+PL I+ P+E G Y V+LF HGT LSN  YS   +++ASHG+IVVAP+L+   PPK      E++ AA+V NW+   LQ  L      VE +L  +A+ GHSRGG  AF LALG+ +N  + +  SAL+G+DPVAG  SV     P +L++  +SF  SIP
Sbjct:   34 ITDVFHKGNFQVTNNPIRVKRYEFSAPEPLIIISPKEAGVYPVLLFIHGTMLSNEDYSLFFNYIASHGFIVVAPKLFRLFPPKLPSQQDEIDMAASVANWMPLYLQVVLQRYVTGVEGDLEKLAISGHSRGGKSAFALALGF-SNIKLDVTFSALIGVDPVAG-RSVDDRTLPHVLTYKPNSFNLSIP 219          
BLAST of DR403986 vs. ExPASy Swiss-Prot
Match: CLH2_ARATH (Chlorophyllase-2, chloroplastic OS=Arabidopsis thaliana GN=CLH2 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.896e-30
Identity = 76/188 (40.43%), Postives = 103/188 (54.79%), Query Frame = 1
Query:  178 PPKPLNIVYPEEKGTYEVILFFHGTALSNTSYSNLLDHLASHGYIVVAPQLYDFLPPKGNGEVNDAANVLNWLSTGLQSELPENVEANLNYVALMGHSRGGLIAFGLAL---GYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSH--DSFEFS---IPXXXXXXXXXXXXKCMQPCAPENKNH 717
            PPK L +  P E+G Y V++  HG  L N+ YS L+ H++SHG+I++APQLY    P    E+   A +++WLS GL   LP  V  NL+  AL GHSRGG  AF +AL   GY++N    +KIS L+GIDPV G      +  PP+L++  +SF+     I                 PCAP   NH
Sbjct:   41 PPKQLLVATPVEEGDYPVVMLLHGYLLYNSFYSQLMLHVSSHGFILIAPQLYSIAGPDTMDEIKSTAEIMDWLSVGLNHFLPAQVTPNLSKFALSGHSRGGKTAFAVALKKFGYSSN----LKISTLIGIDPVDGTGK-GKQTPPPVLAYLPNSFDLDKTPILVIGSGLGETARNPLFPPCAPPGVNH 223          
The following BLAST results are available for this feature:
BLAST of DR403986 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
CLH1_CITUN1.291e-5452.84Chlorophyllase-1, chloroplastic OS=Citrus unshiu P... [more]
CLH1_CITSI1.864e-5351.97Chlorophyllase-1, chloroplastic OS=Citrus sinensis... [more]
CLH1_ARATH1.637e-4149.73Chlorophyllase-1 OS=Arabidopsis thaliana GN=CLH1 P... [more]
CLH0_CHEAL9.955e-3142.02Chlorophyllase type 0 OS=Chenopodium album GN=CACL... [more]
CLH2_ARATH2.896e-3040.43Chlorophyllase-2, chloroplastic OS=Arabidopsis tha... [more]
back to top
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCSAH-PNP1246O14 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone CSAH-PNP1246O14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403986 ID=DR403986|Name=DR403986|organism=Citrus sinensis|type=EST|length=717bp
GGGGGTACACAAACTCAATACTCAAACAATTTAGACTCAATGACAGCATT
AGCCGATAGCAAGCCCGTCTCCGTTGAAGCTAAGCCTGGTTTGGCAACGG
CCTTACTATCAGTTTTTTCAAGTGGACCTTATTCTCCGAAACTCAAGACA
GTGAATAAACCATGGTTTAATAGTTTTCCTCCAAAGCCGTTGAATATTGT
TTATCCAGAAGAAAAAGGAACATATGAAGTTATTTTGTTCTTCCACGGCA
CTGCTCTCAGCAACACAAGCTATTCCAATCTCTTAGACCACTTGGCTTCC
CATGGATACATCGTTGTTGCCCCTCAGTTATACGATTTTCTGCCGCCGAA
AGGAAACGGAGAAGTTAACGATGCAGCAAACGTCCTCAACTGGTTATCAA
CAGGCCTTCAATCAGAACTCCCGGAAAATGTTGAAGCTAACCTAAACTAC
GTTGCTCTTATGGGACACAGTCGCGGAGGACTAATAGCGTTCGGTCTGGC
ACTTGGCTATGCAACAAATCCTCCAGTTAGCATTAAAATTTCAGCATTAG
TAGGCATAGACCCAGTTGCCGGGTTAGCCAGCGTTCATAGTGAACTTGAA
CCCCCGATTCTCAGTCATGACTCATTCGAGTTCTCAATTCCTGTTACTGT
AATTGGCACCGGACTCGGTGGTGTGACAAAGTGCATGCAGCCTTGTGCAC
CGGAAAACAAAAACCAT
back to top