DR403984

Overview
NameDR403984
Unique NameDR403984
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length686
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9848 contig Csv1_Contig9848:65..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403984 vs. ExPASy Swiss-Prot
Match: G2OX8_ARATH (Gibberellin 2-beta-dioxygenase 8 OS=Arabidopsis thaliana GN=GA2OX7 PE=1 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 3.873e-21
Identity = 71/210 (33.81%), Postives = 108/210 (51.43%), Query Frame = 3
Query:   57 SEEWGCFRVVNHKVSSTLMAEMKQVVGELLDLPLEIKRRNTDVIAGSGYMAPTQKNPLYEALGLYDMASSQAVADFCSHLDASPHQRETIEKYAQAIQELAVDLAHKLAESMGLMDSVFQDW----PCQFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAGAFVPVDPLPGTLLVNLGDIATVWSNGRLLNVKHRV 674
            S EWG F+V+NH +S  ++ +M+Q    +   P + K ++    AGS Y   T        L  +  A    + D   + D +     T+EK+A   + LA  LA  LAE  G   S F++      C  R+N+Y   P+     G+  HTDS FLTIL  D+ VGGL+++ +   ++ V P P  L++N+GD+   WSNG   +V+HRV
Sbjct:   69 SREWGFFQVINHGISMDVLEKMRQEQIRVFREPFDKKSKSEKFSAGS-YRWGTPSATSIRQLS-WSEAFHVPMTDISDNKDFTTLS-STMEKFASESEALAYMLAEVLAEKSGQNSSFFKENCVRNTCYLRMNRYPPCPKPSEVYGLMPHTDSDFLTILYQDQ-VGGLQLI-KDNRWIAVKPNPKALIINIGDLFQAWSNGMYKSVEHRV 273          
BLAST of DR403984 vs. ExPASy Swiss-Prot
Match: G3OX4_ARATH (Gibberellin 3-beta-dioxygenase 4 OS=Arabidopsis thaliana GN=At1g80330 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.055e-18
Identity = 67/225 (29.78%), Postives = 111/225 (49.33%), Query Frame = 3
Query:   57 SEEWGCFRVVNHKVSSTLMAEMKQVVGELLDLPLEIKRRNTDVIAG-SGYMAPTQKNPLYEALGLYDMASSQAVADFCSHLDAS-PHQRET----IEKYAQAIQELAVDLAHKLAESMGLMDSVFQDWPCQF------------RINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAGAFVPVDPLPGTLLVNLGDIATVWSNGRLLNVKHRVQ 677
            S+ WG F++ NH +S  L+ +++ +   L D+P E K        G SGY  P + +P +E   ++    + A   + +H +   PH        I++Y   +++LA  L + +  S+G+     + W  +             R+N Y   PE   + G+  HTDS  LTIL    N GGL+V      +V V+P PG L+VN+GD+  + SNG++ +V HR +
Sbjct:   67 SKTWGAFQIANHGISQKLLDDIESLSKTLFDMPSERKLEAASSDKGVSGYGEP-RISPFFEKK-MWSEGFTIADDSYRNHFNTLWPHDHTKYCGIIQEYVDEMEKLASRLLYCILGSLGVTVEDIE-WAHKLEKSGSKVGRGAIRLNHYPVCPEPERAMGLAAHTDSTILTILHQS-NTGGLQVFREESGWVTVEPAPGVLVVNIGDLFHILSNGKIPSVVHRAK 287          
BLAST of DR403984 vs. ExPASy Swiss-Prot
Match: SRG1_ARATH (Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.350e-18
Identity = 64/224 (28.57%), Postives = 116/224 (51.79%), Query Frame = 3
Query:   33 QLKKLRXXSEEWGCFRVVNHKVSSTLMAEMKQVVGELLDLPLEIKRR---NTDVIAGSGYMAPTQKNPLYEALGLYDMASSQAVADFCSHL--DASPHQRETIEKYAQAIQELAVDLAHKLAESMGL----MDSVFQDWPC--QFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAGAFVPVDPLPGTLLVNLGDIATVWSNGRLLNVKHR 671
            +++KL    +EWG F++VNH + S+ + ++K  + +  +LP+E K++     D I G G      ++   +   L+   + Q V     HL        R+T+E Y+  +Q +A  L  K+A ++ +    ++ +F D       R+N Y   P+     G+  H+DS  LT+L    +V GL++  + G +VPV PLP   +VN+GD+  + +NG   +++HR
Sbjct:   70 EVEKLDFACKEWGFFQLVNHGIDSSFLDKVKSEIQDFFNLPMEEKKKFWQRPDEIEGFGQAFVVSEDQKLDWADLF-FHTVQPVELRKPHLFPKLPLPFRDTLEMYSSEVQSVAKILIAKMARALEIKPEELEKLFDDVDSVQSMRMNYYPPCPQPDQVIGLTPHSDSVGLTVLMQVNDVEGLQI-KKDGKWVPVKPLPNAFIVNIGDVLEIITNGTYRSIEHR 291          
BLAST of DR403984 vs. ExPASy Swiss-Prot
Match: ACCH3_SOLLC (1-aminocyclopropane-1-carboxylate oxidase homolog OS=Solanum lycopersicum GN=ACO3 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.836e-18
Identity = 69/225 (30.67%), Postives = 115/225 (51.11%), Query Frame = 3
Query:   42 KLRXXSEEWGCFRVVNHKVSSTLMAEMKQVVGELLDLPLEIKRRNTDVIAGSGYMAPTQKNPLYEA-LGLYDM---ASSQAVADFCSHLDASPHQRE-------TIEKYAQAIQELAVDLAHKLAESMGLMDSVFQDWPCQFRI----NKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAGAFVPVDPLPGTLLVNLGDIATVWSNGRLLNVKHR 671
            K+R  SE+WG F+VVNH + ++++    Q   +  +   E+K++         Y   T K  +Y + L LY     A+S     FC      P  +E       ++  +++ +++L   L   L+E +GL  S  +D+   F +    N Y   P+   + G   HTD GF+TIL  D+ +GGL+V+ +   +V V P PG+L+VN+GD   + SN + L+V+HR
Sbjct:   79 KVRDASEKWGFFQVVNHGIPTSVLDRTLQGTRQFFEQDNEVKKQY--------YTRDTAKKVVYTSNLDLYKSSVPAASWRDTIFCYMAPNPPSLQEFPTPCGESLIDFSKDVKKLGFTLLELLSEGLGLDRSYLKDYMDCFHLFCSCNYYPPCPQPELTMGTIQHTDIGFVTILLQDD-MGGLQVLHQ-NHWVDVPPTPGSLVVNIGDFLQLLSNDKYLSVEHR 293          
BLAST of DR403984 vs. ExPASy Swiss-Prot
Match: FL3H_DIACA (Naringenin,2-oxoglutarate 3-dioxygenase OS=Dianthus caryophyllus GN=FHT PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.684e-16
Identity = 66/223 (29.60%), Postives = 105/223 (47.09%), Query Frame = 3
Query:   39 KKLRXXSEEWGCFRVVNHKVSSTLMAEMKQVVGELLDLPLEIKRRNTDVIAG-------SGYMAPTQKNPLYEALGLYDMASSQAVADFCSHLDASPHQRETIEKYAQAIQELAVDLAHKLAESMGL----MDSVFQDWPCQFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAG-AFVPVDPLPGTLLVNLGDIATVWSNGRLLNVKHR 671
            +K+    E+WG F+VV+H V   L+A+M ++  E   LP E K R  D+  G       S ++         E +  +   ++    D+    D      +  E+Y+  +  LA  L   L+E+MGL    +     D   +  +N Y   P+   + G++ HTD G +T+L  D+ VGGL+     G  ++ V P+PG  +VNLGD     SNGR  N  H+
Sbjct:   59 RKIVEACEDWGIFQVVDHGVGDDLIADMTRLAREFFALPAEEKLR-FDMSGGKKGGFIVSSHLQGEVVQDWREIVTYFSYPTNSR--DYTRWPDKPEGWIKVTEEYSNKLMTLACTLLGVLSEAMGLELEALTKACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQ-VGGLQATRDGGKTWITVQPVPGAFVVNLGDHGHFLSNGRFKNADHQ 277          
BLAST of DR403984 vs. ExPASy Swiss-Prot
Match: FNSI_PETCR (Flavone synthase OS=Petroselinum crispum GN=FNSI PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.872e-16
Identity = 71/225 (31.56%), Postives = 104/225 (46.22%), Query Frame = 3
Query:   27 PKQLKKLRXXSEEWGCFRVVNHKVSSTLMAEMKQVVGELLDLPLEIKRRNTDVIAG--SGYMAPT--QKNPLYEALGLYDMASSQAVADFCSHLDASPH-QRETIEKYAQAIQELAVDLAHKLAESMGL----MDSVFQDWPCQFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLE-VMDRAGAFVPVDPLPGTLLVNLGDIATVWSNGRLLNVKHR 671
            P+  +K+    E+WG F+VV+H + S L++EM ++  E   LP E ++   D   G   G+   T  Q +   +        S    A   S     P   R T E Y++ +  L   L   L+E+MGL    +     D   +  IN Y   P+   + GV+ HTD G +TIL  D  VGGL+   D    ++ V P+ G  +VNLGD     SNGR  N  H+
Sbjct:   55 PEICRKIVKACEDWGIFQVVDHGIDSGLISEMTRLSREFFALPAE-EKLEYDTTGGKRGGFTISTVLQGDDAMDWREFVTYFSYPINARDYSRWPKKPEGWRSTTEVYSEKLMVLGAKLLEVLSEAMGLEKGDLTKACVDMEQKVLINYYPTCPQPDLTLGVRRHTDPGTITILLQD-MVGGLQATRDGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFRNADHQ 277          
BLAST of DR403984 vs. ExPASy Swiss-Prot
Match: FL3H_MALDO (Naringenin,2-oxoglutarate 3-dioxygenase OS=Malus domestica PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.872e-16
Identity = 67/223 (30.04%), Postives = 104/223 (46.64%), Query Frame = 3
Query:   39 KKLRXXSEEWGCFRVVNHKVSSTLMAEMKQVVGELLDLPLEIKRRNTDVIAG-------SGYMAPTQKNPLYEALGLYDMASSQAVADFCSHLDASPHQRETIEKYAQAIQELAVDLAHKLAESMGL----MDSVFQDWPCQFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVM-DRAGAFVPVDPLPGTLLVNLGDIATVWSNGRLLNVKHR 671
            KK+    E+WG F++V+H V + L++EM  +  E   LP E K R  D+  G       S ++         E +  +         D+    D     RE  +KY+  +  LA  L   L+E+MGL    +     D   +  +N Y   P+   + G++ HTD G +T+L  D+ VGGL+   D    ++ V P+ G  +VNLGD   + SNGR  N  H+
Sbjct:   59 KKIVAACEDWGIFQIVDHGVDAELISEMTGLAREFFALPSEEKLR-FDMSGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPIRHR--DYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGLDTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQ-VGGLQATRDDGKTWITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQ 277          
BLAST of DR403984 vs. ExPASy Swiss-Prot
Match: GAOX2_ORYSJ (Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. japonica GN=20ox2 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.425e-15
Identity = 73/216 (33.80%), Postives = 101/216 (46.76%), Query Frame = 3
Query:   69 GCFRVVNHKVSSTLMAEMKQVVGELLDLPLEIKRRNTDVIAG-SGYMAP-----TQKNPLYEAL--GLYDMASSQAVADFCSHL---DASPHQRETIEKYAQAIQELAVDLAHKLAESMGL----MDSVFQDWPCQFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAGAFVPVDPLPGTLLVNLGDIATVWSNGRLLNVKHR 671
            G F+V  H V + L         +   LPL  KRR   V    SGY +        K P  E L  G +D A++  VAD+ S     D +P  R   +KY + ++EL++ +   L  S+G+        F D     R N Y   PE   + G   H D   LTIL  D+ VGGLEV+   G + PV P+PG +++N+GD     SNGR  +  HR
Sbjct:   94 GFFQVSEHGVDAALARAALDGASDFFRLPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFGFHDRAAAPVVADYFSSTLGPDFAPMGR-VYQKYCEEMKELSLTIMELLELSLGVERGYYREFFADSSSIMRCNYYPPCPEPERTLGTGPHCDPTALTILLQDD-VGGLEVLVD-GEWRPVSPVPGAMVINIGDTFMALSNGRYKSCLHR 306          
BLAST of DR403984 vs. ExPASy Swiss-Prot
Match: GAOX2_ORYSI (Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. indica GN=20ox2 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.425e-15
Identity = 73/216 (33.80%), Postives = 101/216 (46.76%), Query Frame = 3
Query:   69 GCFRVVNHKVSSTLMAEMKQVVGELLDLPLEIKRRNTDVIAG-SGYMAP-----TQKNPLYEAL--GLYDMASSQAVADFCSHL---DASPHQRETIEKYAQAIQELAVDLAHKLAESMGL----MDSVFQDWPCQFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAGAFVPVDPLPGTLLVNLGDIATVWSNGRLLNVKHR 671
            G F+V  H V + L         +   LPL  KRR   V    SGY +        K P  E L  G +D A++  VAD+ S     D +P  R   +KY + ++EL++ +   L  S+G+        F D     R N Y   PE   + G   H D   LTIL  D+ VGGLEV+   G + PV P+PG +++N+GD     SNGR  +  HR
Sbjct:   94 GFFQVSEHGVDAALARAALDGASDFFRLPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFGFHDRAAAPVVADYFSSTLGPDFAPMGR-VYQKYCEEMKELSLTIMELLELSLGVERGYYREFFADSSSIMRCNYYPPCPEPERTLGTGPHCDPTALTILLQDD-VGGLEVLVD-GEWRPVSPVPGAMVINIGDTFMALSNGRYKSCLHR 306          
BLAST of DR403984 vs. ExPASy Swiss-Prot
Match: FL3H_PETCR (Flavanone 3-dioxygenase OS=Petroselinum crispum GN=FHT PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.425e-15
Identity = 66/222 (29.73%), Postives = 104/222 (46.85%), Query Frame = 3
Query:   39 KKLRXXSEEWGCFRVVNHKVSSTLMAEMKQVVGELLDLPLEIKRRNTDVIAGS--GYMAPTQKNPL----YEALGLYDMASSQAVADFCSHLDASPHQRETIEKYAQAIQELAVDLAHKLAESMGL----MDSVFQDWPCQFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAG-AFVPVDPLPGTLLVNLGDIATVWSNGRLLNVKHR 671
            +K+    E+WG F+VV+H +   L++EM ++  +   LP E K R  D+  G   G++  +         +  +  Y     QA  D+    D     R   E Y+  +  LA  L   L+E+MGL    +     D   +  +N Y   P+   + G++ HTD G +T+L  D+ VGGL+     G  ++ V P+ G  +VNLGD     SNGR  N  H+
Sbjct:   59 RKIVEACEDWGIFQVVDHGIDIDLISEMTRLARQFFALPAEEKLR-FDMTGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPIQA-RDYSRWPDKPEGWRSITEMYSDELMALACKLLEVLSEAMGLEKEGLTKACVDMDQKVIVNYYPKCPQPNLTLGLKRHTDPGTITLLLQDQ-VGGLQATRDGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQ 277          
The following BLAST results are available for this feature:
BLAST of DR403984 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 48
Match NameE-valueIdentityDescription
G2OX8_ARATH3.873e-2133.81Gibberellin 2-beta-dioxygenase 8 OS=Arabidopsis th... [more]
G3OX4_ARATH1.055e-1829.78Gibberellin 3-beta-dioxygenase 4 OS=Arabidopsis th... [more]
SRG1_ARATH2.350e-1828.57Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 ... [more]
ACCH3_SOLLC6.836e-1830.671-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
FL3H_DIACA1.684e-1629.60Naringenin,2-oxoglutarate 3-dioxygenase OS=Dianthu... [more]
FNSI_PETCR2.872e-1631.56Flavone synthase OS=Petroselinum crispum GN=FNSI P... [more]
FL3H_MALDO2.872e-1630.04Naringenin,2-oxoglutarate 3-dioxygenase OS=Malus d... [more]
GAOX2_ORYSJ1.425e-1533.80Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. ja... [more]
GAOX2_ORYSI1.425e-1533.80Gibberellin 20 oxidase 2 OS=Oryza sativa subsp. in... [more]
FL3H_PETCR1.425e-1529.73Flavanone 3-dioxygenase OS=Petroselinum crispum GN... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCSAH-PNP1246O12 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone CSAH-PNP1246O12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403984 ID=DR403984|Name=DR403984|organism=Citrus sinensis|type=EST|length=686bp
GGGGGACGATAGATCTGCGGTAATTCCCGAAGCAGCTGAAGAAACTGAGA
GNNNNNAGCGAGGAATGGGGATGCTTCAGGGTGGTGAACCACAAGGTCTC
GTCAACGCTGATGGCGGAAATGAAGCAAGTGGTGGGGGAGCTTTTGGATC
TTCCTCTCGAGATCAAACGACGCAACACCGATGTGATCGCCGGCAGCGGC
TACATGGCTCCCACCCAGAAGAATCCTCTGTATGAAGCTTTGGGTCTCTA
CGACATGGCTTCTTCTCAAGCTGTTGCTGACTTTTGTTCTCACCTGGATG
CCTCTCCTCATCAGAGAGAGACAATAGAGAAATATGCTCAAGCAATACAA
GAGTTGGCCGTGGATTTGGCGCATAAATTGGCCGAGAGTATGGGGTTGAT
GGACAGTGTGTTCCAGGATTGGCCTTGCCAGTTTAGGATAAACAAGTACA
ACTTCGCTCCAGAAAGCGTAGGCTCCCCTGGAGTGCAATTACACACAGAT
TCAGGGTTCCTTACTATTCTTCAAGATGATGAAAATGTTGGTGGCCTCGA
AGTGATGGACAGAGCTGGTGCATTTGTACCTGTTGATCCCTTGCCCGGCA
CCCTCCTTGTCAATCTTGGAGACATTGCCACGGTATGGAGTAACGGAAGG
TTGCTCAATGTGAAGCATAGAGTGCAGTGCAAGGAA
back to top