CX069514

Overview
NameCX069514
Unique NameCX069514
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length884
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7623 contig Csv1_Contig7623:203..1085. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX069514 vs. ExPASy Swiss-Prot
Match: P2C59_ARATH (Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana GN=WIN2 PE=1 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 4.908e-92
Identity = 169/185 (91.35%), Postives = 177/185 (95.68%), Query Frame = -1
Query:  330 AIADAYSHTDSEFLKSENNQNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAIAVSRDHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEVIDSSLEFLILASDGLWDVVTNEEAVAMIKPIQDPEEAAKRLMQEAYQRGSADNITCVVVRFLANQGG 884
            AIADAY+ TDSEFLKSEN+QNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAIAVSRDHKPDQ+DERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEE +DSSLEFLILASDGLWDVV+NEEAV MIK I+DPEE AKRLM EAYQRGSADNITCVVVRF ++Q G
Sbjct:  101 AIADAYNQTDSEFLKSENSQNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAIAVSRDHKPDQSDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEKVDSSLEFLILASDGLWDVVSNEEAVGMIKAIEDPEEGAKRLMMEAYQRGSADNITCVVVRFFSDQAG 285          
BLAST of CX069514 vs. ExPASy Swiss-Prot
Match: P2C10_ORYSJ (Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica GN=Os02g0149800 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 4.753e-87
Identity = 156/180 (86.67%), Postives = 175/180 (97.22%), Query Frame = -1
Query:  345 AIADAYSHTDSEFLKSENNQNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAIAVSRDHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEVIDSSLEFLILASDGLWDVVTNEEAVAMIKPIQDPEEAAKRLMQEAYQRGSADNITCVVVRFL 884
            AIA+ Y+HTDSEFLK+E++  RDAGSTASTAILVGDRLLVANVGDSRAV+CRGG+AIAVSRDHKPDQ+DERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGD+LLKQYVVADPEI+EE++DSSLEFLILASDGLWDVV+N+EAV M++PIQDPE+AAKRL+QEAYQRGSADNIT V+VRFL
Sbjct:  150 AIAETYNHTDSEFLKAESSHTRDAGSTASTAILVGDRLLVANVGDSRAVVCRGGDAIAVSRDHKPDQSDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDKLLKQYVVADPEIKEEIVDSSLEFLILASDGLWDVVSNKEAVDMVRPIQDPEQAAKRLLQEAYQRGSADNITVVIVRFL 329          
BLAST of CX069514 vs. ExPASy Swiss-Prot
Match: P2C59_ORYSJ (Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 5.256e-86
Identity = 158/183 (86.34%), Postives = 173/183 (94.54%), Query Frame = -1
Query:  336 AIADAYSHTDSEFLKSENNQNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAIAVSRDHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEVIDSSLEFLILASDGLWDVVTNEEAVAMIKPIQDPEEAAKRLMQEAYQRGSADNITCVVVRFLANQ 884
            AIA+ Y+ TDSE LK+E + NRDAGSTASTAILVGDRLLVANVGDSRAVICRGG+AIAVSRDHKPDQ+DERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGD+LLKQYVVADPEI+EEV+DSSLEFLILASDGLWDVVTNEEAVAM+KPI D E+AAK+L+QEA QRGSADNITC+VVRFL  +
Sbjct:  132 AIAETYTSTDSELLKAETSHNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGDAIAVSRDHKPDQSDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDKLLKQYVVADPEIKEEVVDSSLEFLILASDGLWDVVTNEEAVAMVKPILDSEQAAKKLLQEASQRGSADNITCLVVRFLEQE 314          
BLAST of CX069514 vs. ExPASy Swiss-Prot
Match: P2C71_ARATH (Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana GN=At5g24940 PE=2 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 1.171e-85
Identity = 160/191 (83.77%), Postives = 174/191 (91.10%), Query Frame = -1
Query:  324 AIADAYSHTDSEFLKSENNQNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAIAVSRDHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEVIDSSLEFLILASDGLWDVVTNEEAVAMIKPIQDPEEAAKRLMQEAYQRGSADNITCVVVRFL----ANQGGSS 884
            AIADAY+HTDSE LKSEN+  RDAGSTASTAILVGDRLLVANVGDSRAVICRGGNA AVSRDHKPDQ+DER+RIE+AGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEE ID SLEFLILASDGLWDV +NEEAVA++K ++DPEE+ K+L+ EA +RGSADNITCVVVRFL    AN  GSS
Sbjct:  101 AIADAYTHTDSELLKSENSHTRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAFAVSRDHKPDQSDERERIENAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEKIDDSLEFLILASDGLWDVFSNEEAVAVVKEVEDPEESTKKLVGEAIKRGSADNITCVVVRFLESKSANNNGSS 291          
BLAST of CX069514 vs. ExPASy Swiss-Prot
Match: P2C69_ARATH (Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana GN=At5g10740 PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 1.431e-83
Identity = 154/187 (82.35%), Postives = 171/187 (91.44%), Query Frame = -1
Query:  324 AIADAYSHTDSEFLKSENNQNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAIAVSRDHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEVIDSSLEFLILASDGLWDVVTNEEAVAMIKPIQDPEEAAKRLMQEAYQRGSADNITCVVVRFLANQGGSS 884
            AI DAY+HTDSE LKSEN+ NRDAGSTASTAILVGDRL+VANVGDSRAVI RGG AIAVSRDHKPDQ+DER+RIE+AGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEE ID +LEFLILASDGLWDV +NE AVAM+K ++DPE++AK+L+ EA +RGSADNITCVVVRFL  +  SS
Sbjct:  101 AITDAYNHTDSELLKSENSHNRDAGSTASTAILVGDRLVVANVGDSRAVISRGGKAIAVSRDHKPDQSDERERIENAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEKIDDTLEFLILASDGLWDVFSNEAAVAMVKEVEDPEDSAKKLVGEAIKRGSADNITCVVVRFLEKKSASS 287          
BLAST of CX069514 vs. ExPASy Swiss-Prot
Match: P2C45_ORYSJ (Probable protein phosphatase 2C 45 OS=Oryza sativa subsp. japonica GN=Os04g0659500 PE=2 SV=2)

HSP 1 Score: 309.686 bits (792), Expect = 1.431e-83
Identity = 155/188 (82.45%), Postives = 171/188 (90.96%), Query Frame = -1
Query:  321 AIADAYSHTDSEFLKSENNQNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAIAVSRDHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEVIDSSLEFLILASDGLWDVVTNEEAVAMIKPIQDPEEAAKRLMQEAYQRGSADNITCVVVRFLANQGGSSF 884
            AI DAY  TDSEFL+S+++QN+  GSTASTA+LVGDRL VANVGDSRA+ICRGGNAIAVS+DHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGD+LLKQYVV DPEI+EEVID SLEFLILASDGLWDVVTNEEAV M + I DPEEAAK+L+QEAY+R S+DNITCVVVRFL  QG S +
Sbjct:   95 AIDDAYKSTDSEFLESDSSQNQ-CGSTASTAVLVGDRLFVANVGDSRAIICRGGNAIAVSKDHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDKLLKQYVVVDPEIREEVIDHSLEFLILASDGLWDVVTNEEAVDMTRSIHDPEEAAKKLLQEAYKRESSDNITCVVVRFLHGQGSSGY 281          
BLAST of CX069514 vs. ExPASy Swiss-Prot
Match: P2C52_ORYSJ (Probable protein phosphatase 2C 52 OS=Oryza sativa subsp. japonica GN=Os05g0587100 PE=2 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 2.897e-68
Identity = 129/192 (67.19%), Postives = 160/192 (83.33%), Query Frame = -1
Query:  312 AIADAYSHTDSEFLKSENNQNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAIAVSRDHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEVIDSSLEFLILASDGLWDVVTNEEAVAMIKPIQDPEEAAKRLMQEAYQRGSADNITCVVVRFLANQ-GGSSFPGS 884
            AI++ Y  TDSEFL SE++ +RD GSTASTA+LVG+ L VANVGDSRAVI + G AIA+S DHKP+++DER+RIE AGG VMWAGTWRVGGVLA+SRAFG+RLLKQ+VVADPEIQE+ ID  LEFLILASDGLWDVV NE+AV+++K  ++PE AA++L + A+ RGS DNITC+VV+F  ++  G S P S
Sbjct:  297 AISETYKKTDSEFLDSESHTHRDDGSTASTAVLVGNHLYVANVGDSRAVISKAGKAIALSEDHKPNRSDERKRIESAGGVVMWAGTWRVGGVLAMSRAFGNRLLKQFVVADPEIQEQEIDDELEFLILASDGLWDVVPNEDAVSLVKIEEEPEAAARKLTETAFSRGSGDNITCIVVKFQHDKMDGDSSPTS 488          
BLAST of CX069514 vs. ExPASy Swiss-Prot
Match: P2C11_ARATH (Probable protein phosphatase 2C 11 OS=Arabidopsis thaliana GN=At1g43900 PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 4.329e-64
Identity = 115/179 (64.25%), Postives = 151/179 (84.36%), Query Frame = -1
Query:  348 AIADAYSHTDSEFLKSENNQNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAIAVSRDHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEVIDSSLEFLILASDGLWDVVTNEEAVAMIKPIQDPEEAAKRLMQEAYQRGSADNITCVVVRF 884
            AI + +  TD E+L  E  Q ++AGSTA+TA L+GD+L+VANVGDSR V  R G+A+ +S DHKPD++DERQRIEDAGGF++WAGTWRVGG+LAVSRAFGD+ LK YV+A+PEIQEE I S+LEF+++ASDGLW+V++N++AVA+++ I D E AA++L+QE Y RGS DNITC+VVRF
Sbjct:  191 AIVEVFKQTDEEYLIEEAGQPKNAGSTAATAFLIGDKLIVANVGDSRVVASRNGSAVPLSDDHKPDRSDERQRIEDAGGFIIWAGTWRVGGILAVSRAFGDKQLKPYVIAEPEIQEEDI-STLEFIVVASDGLWNVLSNKDAVAIVRDISDAETAARKLVQEGYARGSCDNITCIVVRF 368          
BLAST of CX069514 vs. ExPASy Swiss-Prot
Match: P2C13_ORYSJ (Probable protein phosphatase 2C 13 OS=Oryza sativa subsp. japonica GN=Os02g0255100 PE=2 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 7.385e-64
Identity = 118/179 (65.92%), Postives = 150/179 (83.80%), Query Frame = -1
Query:  348 AIADAYSHTDSEFLKSENNQNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAIAVSRDHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEVIDSSLEFLILASDGLWDVVTNEEAVAMIKPIQDPEEAAKRLMQEAYQRGSADNITCVVVRF 884
            AI++ Y  TD++FL+SE+N  RD GSTASTA+LVG  L VANVGDSRAV+ + G A+A+S DHKP+++DER+RIE+AGG V+WAGTWRVGGVLA+SRAFG+RLLK +VVA+PEIQEE+++  LE L+LASDGLWDVV NEEAV++ K    PE  A++L + AY RGSADNITC+VV+F
Sbjct:  179 AISETYQKTDTDFLESESNAFRDDGSTASTAVLVGGHLYVANVGDSRAVVSKAGKAMALSEDHKPNRSDERKRIENAGGVVIWAGTWRVGGVLAMSRAFGNRLLKPFVVAEPEIQEELVNEDLECLVLASDGLWDVVENEEAVSLAKTEDLPESVARKLTEIAYSRGSADNITCIVVQF 357          
BLAST of CX069514 vs. ExPASy Swiss-Prot
Match: P2C07_ORYSJ (Probable protein phosphatase 2C 7 OS=Oryza sativa subsp. japonica GN=Os01g0618200 PE=2 SV=2)

HSP 1 Score: 243.047 bits (619), Expect = 1.645e-63
Identity = 117/180 (65.00%), Postives = 148/180 (82.22%), Query Frame = -1
Query:  345 AIADAYSHTDSEFLKSENNQNRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAIAVSRDHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQEEVIDSSLEFLILASDGLWDVVTNEEAVAMIKPIQDPEEAAKRLMQEAYQRGSADNITCVVVRFL 884
            AI++ Y  TDS+FL +E N NR+ GSTASTAI VG+ + VANVGDSR V+ + G AIA+S DHKP++ DER+RIE+AGG V W+GTWRVGGVLA+SRAFG+R LK++VVA+PE+QE+ ID  LEFLILASDGLWDVV+NE AVA +K  + PE AA++L + A+ RGS DNITC+VV+FL
Sbjct:  183 AISETYRKTDSDFLDAETNINREDGSTASTAIFVGNHIYVANVGDSRTVMSKAGKAIALSSDHKPNRKDERKRIENAGGVVTWSGTWRVGGVLAMSRAFGNRFLKRFVVAEPEVQEQEIDDDLEFLILASDGLWDVVSNEHAVAFVKAEEGPEAAARKLAEIAFARGSTDNITCIVVKFL 362          
The following BLAST results are available for this feature:
BLAST of CX069514 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 199
Match NameE-valueIdentityDescription
P2C59_ARATH4.908e-9291.35Probable protein phosphatase 2C 59 OS=Arabidopsis ... [more]
P2C10_ORYSJ4.753e-8786.67Probable protein phosphatase 2C 10 OS=Oryza sativa... [more]
P2C59_ORYSJ5.256e-8686.34Probable protein phosphatase 2C 59 OS=Oryza sativa... [more]
P2C71_ARATH1.171e-8583.77Probable protein phosphatase 2C 71 OS=Arabidopsis ... [more]
P2C69_ARATH1.431e-8382.35Probable protein phosphatase 2C 69 OS=Arabidopsis ... [more]
P2C45_ORYSJ1.431e-8382.45Probable protein phosphatase 2C 45 OS=Oryza sativa... [more]
P2C52_ORYSJ2.897e-6867.19Probable protein phosphatase 2C 52 OS=Oryza sativa... [more]
P2C11_ARATH4.329e-6464.25Probable protein phosphatase 2C 11 OS=Arabidopsis ... [more]
P2C13_ORYSJ7.385e-6465.92Probable protein phosphatase 2C 13 OS=Oryza sativa... [more]
P2C07_ORYSJ1.645e-6365.00Probable protein phosphatase 2C 7 OS=Oryza sativa ... [more]

Pages

back to top
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-2cdna_library
Properties
Property NameValue
Genbank descriptionUCRCS08_11A01_b Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA clone UCRCS08-11A01-B1-1-5.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX069514 ID=CX069514|Name=CX069514|organism=Citrus sinensis|type=EST|length=884bp
TTTTTTTTTTTTTTTTCTTTTAGGAAATTGAAACTTTAGAAGTCTTTGCC
AATTCTTTACACATGCATACATACACATTTCTAGCTACATTTCGAGGACC
GAGAACAGATGTTAAACTTCGGACACATCTATTCCAGAGACTGATAATAC
GTAATACACATTAACGGCCGGGGTAAGCTTTTTGTTCATGTTCTATCATT
ACAAAGTACAACGAAACTGTAATTTTTCTATGACTACTAGCTGTAGACCA
CTGAAAGGATGCCCATGTAGAGAACAAAAGCAGAGCGGTGGCTATGAAAG
GATGTTCATGCAGAGCCAGGAAAGGATGAACCACCTTGATTGGCCAAGAA
CCGAACAACGACACAGGTGATGTTGTCTGCGCTGCCTCTCTGATATGCCT
CCTGCATCAGCCTCTTCGCTGCCTCCTCTGGATCCTGGATTGGTTTGATC
ATCGCAACAGCTTCCTCATTTGTGACGACATCCCAAAGTCCATCACTTGC
AAGGATAAGAAACTCAAGGGAGCTGTCAATAACTTCCTCCTGAATTTCGG
GATCAGCAACAACATACTGCTTCAAGAGTCTGTCACCAAATGCGCGAGAA
ACGGCAAGAACTCCTCCCACTCTCCAAGTTCCAGCCCACATCACAAACCC
TCCTGCATCCTCAATCCGTTGACGCTCATCTGTTTGGTCTGGTTTGTGAT
CTCGCGATACGGCAATAGCATTACCGCCCCTGCATATAACAGCTCTGGAG
TCACCCACATTTGCAACAAGTAAGCGATCACCAACAAGGATGGCAGTGGA
AGCAGTAGATCCAGCATCCCTGTTTTGATTGTTTTCTGACTTCAGAAATT
CCGAGTCTGTGTGGCTGTATGCATCAGCTATTGC
back to top