CX069492

Overview
NameCX069492
Unique NameCX069492
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length832
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2633 contig Csv1_Contig2633:97..929. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX069492 vs. ExPASy Swiss-Prot
Match: PGKY_TOBAC (Phosphoglycerate kinase, cytosolic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 3.099e-101
Identity = 188/202 (93.07%), Postives = 197/202 (97.52%), Query Frame = -2
Query:  226 GSKVSTKIRVIESLLEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA 831
            GSKVS+KI VIESLLEKVD+LLLGGGMIFTFYKAQG++VGSSLVEEDKLDLATSLMEKAK+KGVSLLLPTDVVIADKFAADANSKVVPA+ IPDGWMGLD+GPDAIKSF  ALDTTKT+IWNGPMGVFEFDKFAAGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLA+KMSHISTGGGASLELLEGK LPGVLALDDA
Sbjct:  200 GSKVSSKIGVIESLLEKVDVLLLGGGMIFTFYKAQGYAVGSSLVEEDKLDLATSLMEKAKAKGVSLLLPTDVVIADKFAADANSKVVPASEIPDGWMGLDIGPDAIKSFGSALDTTKTVIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLAEKMSHISTGGGASLELLEGKPLPGVLALDDA 401          
BLAST of CX069492 vs. ExPASy Swiss-Prot
Match: PGKH_TOBAC (Phosphoglycerate kinase, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 6.687e-96
Identity = 176/202 (87.13%), Postives = 194/202 (96.04%), Query Frame = -2
Query:  226 GSKVSTKIRVIESLLEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA 831
            GSKVS+KI VIESLLEK DILLLGGGMIFTFYKAQG SVGSSLVEEDKL+LATSL+EKAK+KGVSLLLP+DVVIADKFA DANSK+VPA+AIPDGWMGLD+GPD++K+F++ALDTTKT+IWNGPMGVFEFDKFA GTEAIAKKLA+LSGKGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct:  274 GSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLEKAKAKGVSLLLPSDVVIADKFAPDANSKIVPASAIPDGWMGLDIGPDSVKTFNDALDTTKTVIWNGPMGVFEFDKFAVGTEAIAKKLADLSGKGVTTIIGGGDSVAAVEKVGVASVMSHISTGGGASLELLEGKVLPGVIALDEA 475          
BLAST of CX069492 vs. ExPASy Swiss-Prot
Match: PGKY_WHEAT (Phosphoglycerate kinase, cytosolic OS=Triticum aestivum PE=2 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 8.734e-96
Identity = 177/202 (87.62%), Postives = 193/202 (95.54%), Query Frame = -2
Query:  226 GSKVSTKIRVIESLLEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA 831
            GSKVS+KI VIESLL KVDIL+LGGGMIFTFYKAQG +VG SLVEEDKL+LATSL+E AKSKGV LLLPTDVV+ADKFAADA SK+VPATAIPDGWMGLDVGPD+IK+F+EALDTTKT+IWNGPMGVFEF+KFAAGT+AIAK+LAEL+GKGVTTIIGGGDSVAAVEK GLADKMSHISTGGGASLELLEGK LPGVLALD+A
Sbjct:  200 GSKVSSKIGVIESLLAKVDILILGGGMIFTFYKAQGLAVGKSLVEEDKLELATSLIETAKSKGVKLLLPTDVVVADKFAADAESKIVPATAIPDGWMGLDVGPDSIKTFAEALDTTKTVIWNGPMGVFEFEKFAAGTDAIAKQLAELTGKGVTTIIGGGDSVAAVEKAGLADKMSHISTGGGASLELLEGKPLPGVLALDEA 401          
BLAST of CX069492 vs. ExPASy Swiss-Prot
Match: PGKH_SPIOL (Phosphoglycerate kinase, chloroplastic (Fragment) OS=Spinacia oleracea PE=2 SV=2)

HSP 1 Score: 344.354 bits (882), Expect = 4.792e-94
Identity = 175/202 (86.63%), Postives = 191/202 (94.55%), Query Frame = -2
Query:  226 GSKVSTKIRVIESLLEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA 831
            GSKVS+KI VIESLLEK DILLLGGGMIFTFYKAQG SVGSSLVEEDKLDLATSL+ KAK KGVSLLLPTDVVIADKFAADA+SK+VPA+ IPDGWMGLD+GPD+IK+FSEALDTT+T+IWNGPMGVFEF+KFAAGTEAIAKKL E+S KG TTIIGGGDSVAAVEKVG+A+ MSHISTGGGASLELLEGK LPGVLAL++A
Sbjct:  227 GSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGMSVGSSLVEEDKLDLATSLLAKAKEKGVSLLLPTDVVIADKFAADADSKIVPASGIPDGWMGLDIGPDSIKTFSEALDTTQTVIWNGPMGVFEFEKFAAGTEAIAKKLEEISKKGATTIIGGGDSVAAVEKVGVAEAMSHISTGGGASLELLEGKQLPGVLALNEA 428          
BLAST of CX069492 vs. ExPASy Swiss-Prot
Match: PGKH_WHEAT (Phosphoglycerate kinase, chloroplastic OS=Triticum aestivum PE=2 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 5.298e-93
Identity = 172/201 (85.57%), Postives = 191/201 (95.02%), Query Frame = -2
Query:  229 GSKVSTKIRVIESLLEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDD 831
            GSKVS+KI VIESLLEK DILLLGGGMIFTFYKAQG SVGSSLVEEDKL+LATSL+ KAK+KGVSLLLP+DV+IADKFA DANS+ VPA+AIPDGWMGLD+GPD++K+F++ALDTT+TIIWNGPMGVFEFDKFA GTE+IAKKLAELS KGVTTIIGGGDSVAAVEKVG+AD MSHISTGGGASLELLEGK LPGV+ALD+
Sbjct:  271 GSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATSLLAKAKAKGVSLLLPSDVIIADKFAPDANSQTVPASAIPDGWMGLDIGPDSVKTFNDALDTTQTIIWNGPMGVFEFDKFAVGTESIAKKLAELSKKGVTTIIGGGDSVAAVEKVGVADVMSHISTGGGASLELLEGKELPGVVALDE 471          
BLAST of CX069492 vs. ExPASy Swiss-Prot
Match: PGKH_ARATH (Phosphoglycerate kinase, chloroplastic OS=Arabidopsis thaliana GN=At1g56190 PE=1 SV=2)

HSP 1 Score: 336.65 bits (862), Expect = 9.992e-92
Identity = 171/202 (84.65%), Postives = 188/202 (93.07%), Query Frame = -2
Query:  226 GSKVSTKIRVIESLLEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA 831
            GSKVS+KI VIESLLEK DILLLGGGMIFTFYKAQG SVGSSLVEEDKL+LAT L+ KAK+KGVSLLLPTDVV+ADKFA DANSK+VPA+ I DGWMGLD+GPD+IK+F+EALDTT+T+IWNGPMGVFE +KFAAGTEAIA KLAELS KGVTTIIGGGDSVAAVEKVG+A  MSHISTGGGASLELLEGK LPGV+ALD+A
Sbjct:  272 GSKVSSKIGVIESLLEKCDILLLGGGMIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKIVPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAELSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEA 473          
BLAST of CX069492 vs. ExPASy Swiss-Prot
Match: PGK_CYAP4 (Phosphoglycerate kinase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=pgk PE=3 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 2.636e-84
Identity = 156/202 (77.23%), Postives = 179/202 (88.61%), Query Frame = -2
Query:  226 GSKVSTKIRVIESLLEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA 831
            GSKVS+KI VIE+LLEKVD LLLGGGMIFTFYKA+G +VG SLVEEDKL+LA +L  KAK +GV+LLLPTDVV+AD FAADAN++ V   +IPDGWMGLD+GPDA+K+F EAL   KT+IWNGPMGVFEFDKFA GTEAIA  LA L+GKG +TIIGGGDSVAAVEKVG+A++MSHISTGGGASLELLEGK LPG++ALDDA
Sbjct:  205 GSKVSSKIGVIETLLEKVDKLLLGGGMIFTFYKARGLNVGKSLVEEDKLELARTLEAKAKERGVALLLPTDVVVADAFAADANAQTVSVESIPDGWMGLDIGPDAVKTFQEALSDCKTVIWNGPMGVFEFDKFAVGTEAIAHSLAGLTGKGASTIIGGGDSVAAVEKVGVAEQMSHISTGGGASLELLEGKELPGIVALDDA 406          
BLAST of CX069492 vs. ExPASy Swiss-Prot
Match: PGK_NOSP7 (Phosphoglycerate kinase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=pgk PE=3 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 2.231e-83
Identity = 157/202 (77.72%), Postives = 174/202 (86.14%), Query Frame = -2
Query:  226 GSKVSTKIRVIESLLEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA 831
            GSKVS+KI VIE+LLEK D L++GGGMIFTFYKA+G SVG SLVEEDKL+LA SL  KAK +GV+LLLPTDVV+AD FA DANS+ V    IPDGWMGLD+GPD++K F EAL  TKT+IWNGPMGVFEFDKFAAGTEAIA  LAE+   G TTIIGGGDSVAAVEKVGLAD+MSHISTGGGASLELLEGK LPG+ ALDDA
Sbjct:  199 GSKVSSKIGVIETLLEKCDKLIIGGGMIFTFYKARGLSVGKSLVEEDKLELAKSLEAKAKERGVALLLPTDVVLADNFAPDANSQTVSIENIPDGWMGLDIGPDSVKFFQEALADTKTVIWNGPMGVFEFDKFAAGTEAIAHTLAEIGKTGTTTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALDDA 400          
BLAST of CX069492 vs. ExPASy Swiss-Prot
Match: PGK_ANAVT (Phosphoglycerate kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pgk PE=3 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 6.492e-83
Identity = 156/202 (77.23%), Postives = 174/202 (86.14%), Query Frame = -2
Query:  226 GSKVSTKIRVIESLLEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA 831
            GSKVS+KI VIE+LLEK D L++GGGMIFTFYKA+G +VG SLVEEDKL+LA SL  KAK +GVSLLLPTDVV+AD FA DANS+ V    IPDGWMGLD+GPD++K F EAL  TKT+IWNGPMGVFEFDKFAAGTEAIA  LAE+   G TTIIGGGDSVAAVEKVGLAD+MSHISTGGGASLELLEGK LPG+ ALD+A
Sbjct:  199 GSKVSSKIGVIETLLEKCDKLIIGGGMIFTFYKARGLNVGKSLVEEDKLELAKSLEAKAKERGVSLLLPTDVVLADNFAPDANSQTVSIDNIPDGWMGLDIGPDSVKVFQEALADTKTVIWNGPMGVFEFDKFAAGTEAIAHTLAEIGKTGTTTIIGGGDSVAAVEKVGLADQMSHISTGGGASLELLEGKVLPGIAALDEA 400          
BLAST of CX069492 vs. ExPASy Swiss-Prot
Match: PGK_SYNS3 (Phosphoglycerate kinase OS=Synechococcus sp. (strain CC9311) GN=pgk PE=3 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 8.479e-83
Identity = 156/202 (77.23%), Postives = 173/202 (85.64%), Query Frame = -2
Query:  226 GSKVSTKIRVIESLLEKVDILLLGGGMIFTFYKAQGHSVGSSLVEEDKLDLATSLMEKAKSKGVSLLLPTDVVIADKFAADANSKVVPATAIPDGWMGLDVGPDAIKSFSEALDTTKTIIWNGPMGVFEFDKFAAGTEAIAKKLAELSGKGVTTIIGGGDSVAAVEKVGLADKMSHISTGGGASLELLEGKTLPGVLALDDA 831
            GSKVS+KI V+E+L++K D +L+GGGMIFTFYKA+G +VG SLVEEDKL+LA  L  KAK+KGV LLLPTDV++AD FA DANS+V   TAIPDGWMGLD+GPDAIK F  AL   KT+IWNGPMGVFEFDKFAAGT AIA  LAELSGKG  TIIGGGDSVAAVEK GLA+KMSHISTGGGASLELLEGK LPGV ALDDA
Sbjct:  200 GSKVSSKIGVLEALIDKCDKVLIGGGMIFTFYKARGLAVGKSLVEEDKLELAKELEAKAKAKGVELLLPTDVLLADNFAPDANSQVADVTAIPDGWMGLDIGPDAIKVFQAALADCKTVIWNGPMGVFEFDKFAAGTNAIATTLAELSGKGCCTIIGGGDSVAAVEKAGLAEKMSHISTGGGASLELLEGKVLPGVAALDDA 401          
The following BLAST results are available for this feature:
BLAST of CX069492 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
PGKY_TOBAC3.099e-10193.07Phosphoglycerate kinase, cytosolic OS=Nicotiana ta... [more]
PGKH_TOBAC6.687e-9687.13Phosphoglycerate kinase, chloroplastic OS=Nicotian... [more]
PGKY_WHEAT8.734e-9687.62Phosphoglycerate kinase, cytosolic OS=Triticum aes... [more]
PGKH_SPIOL4.792e-9486.63Phosphoglycerate kinase, chloroplastic (Fragment) ... [more]
PGKH_WHEAT5.298e-9385.57Phosphoglycerate kinase, chloroplastic OS=Triticum... [more]
PGKH_ARATH9.992e-9284.65Phosphoglycerate kinase, chloroplastic OS=Arabidop... [more]
PGK_CYAP42.636e-8477.23Phosphoglycerate kinase OS=Cyanothece sp. (strain ... [more]
PGK_NOSP72.231e-8377.72Phosphoglycerate kinase OS=Nostoc punctiforme (str... [more]
PGK_ANAVT6.492e-8377.23Phosphoglycerate kinase OS=Anabaena variabilis (st... [more]
PGK_SYNS38.479e-8377.23Phosphoglycerate kinase OS=Synechococcus sp. (stra... [more]

Pages

back to top
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-2cdna_library
Properties
Property NameValue
Genbank descriptionUCRCS08_10G07_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA clone UCRCS08-10G07-M14-1-4.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX069492 ID=CX069492|Name=CX069492|organism=Citrus sinensis|type=EST|length=832bp
GAAACTTATAGCCTTACCATCACAATGTTCCAAAATGGGATCAAATCCAG
AAAAATGCATCACCATTGATGCCTGTGAGAAAGAATTTATTTTTACTCTT
ACAGCATCTACAAAACCAACTCTAATGATAAAGTTTAACTTTATCCACTC
TGGGCTGACAACCAGCCACACATACAACTCTGGAAATGGCACATTTAAAA
AAGGAAAGTCCAGGAACTGGGTTTAAGCATCATCAAGAGCAAGCACACCA
GGGAGTGTTTTGCCCTCAAGGAGCTCTAAGCTGGCTCCACCTCCAGTGGA
GATATGGCTCATCTTGTCAGCCAGACCAACCTTCTCTACGGCTGCAACTG
AGTCACCTCCTCCAATGATTGTGGTCACTCCCTTCCCGCTGAGCTCCGCA
AGCTTCTTGGCAATTGCCTCAGTGCCAGCAGCAAATTTATCAAATTCAAA
CACACCCATAGGTCCATTCCAGATGATGGTTTTAGTAGTATCCAAAGCTT
CACTGAATGACTTGATGGCATCAGGTCCAACATCCAAGCCCATCCAACCA
TCTGGAATTGCCGTTGCTGGCACCACCTTGCTGTTGGCATCAGCAGCAAA
CTTGTCAGCAATAACAACATCAGTAGGGAGCAGAAGAGACACCCCTTTAG
ATTTGGCCTTCTCCATAAGTGACGTAGCGAGATCAAGCTTGTCTTCCTCA
ACAAGGGATGAACCAACAGAGTGTCCTTGGGCCTTGTAAAAGGTAAAGAT
CATTCCTCCACCGAGCAATAGAATGTCAACCTTCTCCAAAAGTGATTCAA
TAACACGGATCTTAGTTGACACCTTTGAACCA
back to top