CX069374

Overview
NameCX069374
Unique NameCX069374
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length805
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5646 contig Csv1_Contig5646:231..1035. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX069374 vs. ExPASy Swiss-Prot
Match: VP321_ARATH (Vacuolar protein sorting-associated protein 32 homolog 1 OS=Arabidopsis thaliana GN=VPS32.1 PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 8.364e-48
Identity = 95/102 (93.14%), Postives = 99/102 (97.06%), Query Frame = 1
Query:   64 AKDYSKAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALSTPIG 369
            AK++S+AKNKRAAIQCLKRKRLYEQQ+EQLGNFQLRIHDQMIMLEGAKATTETVDALRTGAS MKAMQKATNIDDVDKTMDEINEQTENMKQIQEALS P G
Sbjct:   48 AKEFSRAKNKRAAIQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALSAPFG 149          
BLAST of CX069374 vs. ExPASy Swiss-Prot
Match: VP322_ARATH (Vacuolar protein sorting-associated protein 32 homolog 2 OS=Arabidopsis thaliana GN=VPS32.2 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 2.434e-47
Identity = 94/102 (92.16%), Postives = 100/102 (98.04%), Query Frame = 1
Query:   64 AKDYSKAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALSTPIG 369
            AK+YS+AKNKRAAIQCLKRKRLYE Q+EQLGNFQLRIHDQMIMLEGAKATTETVDALR+GAS MKAMQKATNIDDVDKTMDEINEQTENMKQIQEAL+TP+G
Sbjct:   47 AKEYSRAKNKRAAIQCLKRKRLYEGQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALATPMG 148          
BLAST of CX069374 vs. ExPASy Swiss-Prot
Match: SNF7_KLULA (Vacuolar-sorting protein SNF7 OS=Kluyveromyces lactis GN=SNF7 PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.348e-13
Identity = 41/101 (40.59%), Postives = 62/101 (61.39%), Query Frame = 1
Query:   64 AKDYSKAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALSTPI 366
            AK   ++ NK  A   LK+K+LYE Q+++L +    +  Q+  +E A    ET+ A++ GAS MK + K  ++D VD TMDEI EQ E  ++I EA+S P+
Sbjct:   48 AKKSLQSGNKNNAKTYLKKKKLYESQLDKLQSQIDSLDQQLYSIENANLNLETLKAMKQGASAMKNIHKGLDLDKVDDTMDEIREQVELNQEISEAISKPL 148          
BLAST of CX069374 vs. ExPASy Swiss-Prot
Match: SNF7_CANAL (Vacuolar-sorting protein SNF7 OS=Candida albicans GN=SNF7 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 8.736e-13
Identity = 39/102 (38.24%), Postives = 58/102 (56.86%), Query Frame = 1
Query:   64 AKDYSKAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALSTPIG 369
            A+ Y  +K    A   LKRK+ YE  + ++ N    +  Q+I +EGA    ET+ A++ GA  MK +    ++D V+ TMDEI EQ E   +I EA+S P+G
Sbjct:   49 ARKYVSSKQTTLAKSALKRKKGYESNLLKVENQIETLETQLISIEGANLNLETMKAMKQGAKAMKQIHGEYDVDKVEDTMDEIREQVELADEISEAISRPVG 150          
BLAST of CX069374 vs. ExPASy Swiss-Prot
Match: CHM4B_DANRE (Charged multivesicular body protein 4b OS=Danio rerio GN=chmp4b PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.490e-12
Identity = 40/95 (42.11%), Postives = 55/95 (57.89%), Query Frame = 1
Query:   85 KNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALSTPIG 369
            KNKRAA+Q LKRK+ YE+Q+ Q+      I  Q   LE A   TE +  +   A  MKA     +ID VD+ M +I EQ E  ++I +A+S P+G
Sbjct:   58 KNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENAHTNTEVIKNMGYAAKAMKAAHDNMDIDKVDELMQDIIEQQELAQEISDAISKPVG 152          
BLAST of CX069374 vs. ExPASy Swiss-Prot
Match: SNF7_SCHPO (Vacuolar-sorting protein snf7 OS=Schizosaccharomyces pombe GN=snf7 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.542e-12
Identity = 33/94 (35.11%), Postives = 58/94 (61.70%), Query Frame = 1
Query:   88 NKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALSTPIG 369
            NKR A+  LKRK+++E ++ ++   +  I  Q+  ++ A    ET+ A+R GA  MK++Q+  + D VD+ MD+I +Q    ++I   +STP+G
Sbjct:   56 NKRLALTALKRKKMHENELVKIEGSRNNIEQQLFSIQNANLNFETLQAMRQGAEAMKSIQRGMDADKVDQIMDKIRDQQTISEEISTMISTPVG 149          
BLAST of CX069374 vs. ExPASy Swiss-Prot
Match: SNF7_CANGA (Vacuolar-sorting protein SNF7 OS=Candida glabrata GN=SNF7 PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.542e-12
Identity = 37/101 (36.63%), Postives = 60/101 (59.41%), Query Frame = 1
Query:   64 AKDYSKAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALSTPI 366
            A+ +    NK  A   LK+K++YE Q+ +L +    +  Q+  +E A    ET+ A++ GA  MK++    +ID VD+TMDEI EQ E  ++I +A+S P+
Sbjct:   49 ARKFLTRGNKTMAKNALKKKKVYEGQLVKLESQMDSLEQQLFSIESANLNLETMRAMKQGAKAMKSIHSGLDIDRVDETMDEIREQVELGEEISDAISRPL 149          
BLAST of CX069374 vs. ExPASy Swiss-Prot
Match: CHM4C_DANRE (Charged multivesicular body protein 4c OS=Danio rerio GN=chmp4c PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.542e-12
Identity = 39/95 (41.05%), Postives = 54/95 (56.84%), Query Frame = 1
Query:   85 KNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALSTPIG 369
            KNKRAA+Q LKRK+ YE+Q+ Q+      I  Q   LE A   TE +  +   A  MK   +  +ID VD  M +I EQ E  ++I +A+S P+G
Sbjct:   58 KNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGFAAKAMKTAHENMDIDKVDDLMQDITEQQELAQEISDAISRPVG 152          
BLAST of CX069374 vs. ExPASy Swiss-Prot
Match: SNF7_ASHGO (Vacuolar-sorting protein SNF7 OS=Ashbya gossypii GN=SNF7 PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.663e-12
Identity = 36/101 (35.64%), Postives = 60/101 (59.41%), Query Frame = 1
Query:   64 AKDYSKAKNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALSTPI 366
            A+ +    NK  A   LKRK+++E Q+ ++      +  Q+  +E A    ET+ A++ GAS MK + +  +++ VD+TMDEI EQ E  ++I EA+S P+
Sbjct:   50 ARHFLSKGNKNMAKAALKRKKVFESQLLKIDKQVDSLEQQLYSIENANLNLETMKAMKQGASAMKHIHEGLDVERVDETMDEIREQVELGEEISEAISRPL 150          
BLAST of CX069374 vs. ExPASy Swiss-Prot
Match: CHM4B_CHICK (Charged multivesicular body protein 4b OS=Gallus gallus GN=CHMP4B PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.663e-12
Identity = 40/95 (42.11%), Postives = 53/95 (55.79%), Query Frame = 1
Query:   85 KNKRAAIQCLKRKRLYEQQIEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASTMKAMQKATNIDDVDKTMDEINEQTENMKQIQEALSTPIG 369
            KNKRAA+Q LKRK+ YE+Q+ Q+      I  Q   LE A   TE +  +   A  MKA     +ID VD+ M +I EQ E   +I  A+S P+G
Sbjct:   62 KNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGFAAKAMKAAHDNMDIDKVDELMQDIAEQQELADEISTAISKPVG 156          
The following BLAST results are available for this feature:
BLAST of CX069374 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
VP321_ARATH8.364e-4893.14Vacuolar protein sorting-associated protein 32 hom... [more]
VP322_ARATH2.434e-4792.16Vacuolar protein sorting-associated protein 32 hom... [more]
SNF7_KLULA1.348e-1340.59Vacuolar-sorting protein SNF7 OS=Kluyveromyces lac... [more]
SNF7_CANAL8.736e-1338.24Vacuolar-sorting protein SNF7 OS=Candida albicans ... [more]
CHM4B_DANRE1.490e-1242.11Charged multivesicular body protein 4b OS=Danio re... [more]
SNF7_SCHPO2.542e-1235.11Vacuolar-sorting protein snf7 OS=Schizosaccharomyc... [more]
SNF7_CANGA2.542e-1236.63Vacuolar-sorting protein SNF7 OS=Candida glabrata ... [more]
CHM4C_DANRE2.542e-1241.05Charged multivesicular body protein 4c OS=Danio re... [more]
SNF7_ASHGO5.663e-1235.64Vacuolar-sorting protein SNF7 OS=Ashbya gossypii G... [more]
CHM4B_CHICK5.663e-1242.11Charged multivesicular body protein 4b OS=Gallus g... [more]

Pages

back to top
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-2cdna_library
Properties
Property NameValue
Genbank descriptionUCRCS08_10A10_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA clone UCRCS08-10A10-A20-1-4.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX069374 ID=CX069374|Name=CX069374|organism=Citrus sinensis|type=EST|length=805bp
CTTGAAATGCTAGAGAAAAAGGAGAAAGTACTCCTGAAAAAGGCTTCTGT
AGAGGTTGAAAAGGCCAAGGACTACTCCAAAGCAAAGAACAAAAGAGCGG
CCATACAATGTTTGAAGAGGAAGAGGCTATACGAACAGCAAATAGAGCAG
CTTGGGAATTTCCAATTGCGCATTCATGATCAGATGATAATGCTAGAAGG
TGCTAAAGCCACAACTGAGACTGTAGATGCATTGAGGACGGGAGCATCGA
CAATGAAGGCTATGCAGAAAGCAACGAACATAGATGATGTGGATAAGACC
ATGGATGAGATCAATGAGCAGACCGAGAACATGAAGCAGATTCAAGAAGC
ATTATCAACTCCTATTGGTGCTGCTGCTGATTTCGATGAGGATGAATTGG
AAGCAGAACTTGAAGAACTGGAAGGTGCTGAGTTGGAAGAGCAGCTTCTA
CAGCCAGCTACAACAGCTCCTGCTGCTCCGGTTCAGGTCCCTGCTGGCAG
GCAACAAGCCCGTCCTGTTCCCCAAAAGCAGCGAACAGCTGAGGAAGATG
AGCTTGCTGCTTTACAAGCTGAGATGGCTCTTTAAGCAGGTTTTACCGCC
ATAATGAAGATATTATTTAAATAGCTGGCCGTATAATGTGGAGATTTATG
CCTACTTGGATTACCTTCAAGATTTCTGTGTGCATTCAATGAACAGACTG
TATATAAAGTTTGCGTAAACTAGTCCTGTTTGAAATATGTATCCTGTATT
CTGTCTTATAGACCTTTTAATTGAGTTCATCATCTTTGATGTGTTTTTTC
CTTCT
back to top