CX069370

Overview
NameCX069370
Unique NameCX069370
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length808
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX069370 vs. ExPASy Swiss-Prot
Match: S22AF_MOUSE (Solute carrier family 22 member 15 OS=Mus musculus GN=Slc22a15 PE=2 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 1.712e-16
Identity = 60/190 (31.58%), Postives = 89/190 (46.84%), Query Frame = -1
Query:  242 GISRATIGTCTIVLLTEKVGTEWRGLVGILDSFFFTIGTLTLPAIAYTNRSSSWTIIYLWTSIP-TLVYSGLLYIFVSESPRWLFMQGRQEEAVEVIKSLSPIKDSNQLSLSLVSAVSFGHEPAAXXXXXXXXXSIRELFVRRWALERTLALMVLGFGIGVVYYGMTLGIENLGFDIYLGVVFNALLEIP 808
            G+    +     VLL E VGT +  L G +   FF +G      + Y  RS  W  + +  ++  TLV+  LL +F+ ESPRWL+ QGR  EA E +  ++      + + SL    +  +                +LF  R  L  TL LM + F   +VYYG+TL   +LG  IY  +  + L+EIP
Sbjct:  173 GMMNGGMSLVAFVLLNECVGTTYWALAGSIGGLFFAVGIAQYALLGYFIRS--WRTLAVLVNLQGTLVF--LLSLFIPESPRWLYSQGRLSEAEEALYFIAKRNRKLKCTFSLTHPANRSYRATGSFL---------DLFRYRILLGHTLILMFIWFVCSLVYYGLTLSAGDLGGSIYANLALSGLIEIP 349          
BLAST of CX069370 vs. ExPASy Swiss-Prot
Match: S22AF_HUMAN (Solute carrier family 22 member 15 OS=Homo sapiens GN=SLC22A15 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.110e-15
Identity = 59/190 (31.05%), Postives = 88/190 (46.32%), Query Frame = -1
Query:  242 GISRATIGTCTIVLLTEKVGTEWRGLVGILDSFFFTIGTLTLPAIAYTNRSSSWTIIYLWTSIP-TLVYSGLLYIFVSESPRWLFMQGRQEEAVEVIKSLSPIKDSNQLSLSLVSAVSFGHEPAAXXXXXXXXXSIRELFVRRWALERTLALMVLGFGIGVVYYGMTLGIENLGFDIYLGVVFNALLEIP 808
            G+    +     VLL E VGT +  L G +   FF +G      + Y  RS  W  + +  ++  T+V+  LL +F+ ESPRWL+ QGR  EA E +  ++      + + SL    +                   +LF  R  L  TL LM + F   +VYYG+TL   +LG  IY  +  + L+EIP
Sbjct:  173 GMMNGGMSLVAFVLLNECVGTAYWALAGSIGGLFFAVGIAQYALLGYFIRS--WRTLAILVNLQGTVVF--LLSLFIPESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFL---------DLFRYRVLLGHTLILMFIWFVCSLVYYGLTLSAGDLGGSIYANLALSGLIEIP 349          
BLAST of CX069370 vs. ExPASy Swiss-Prot
Match: S22A3_RAT (Solute carrier family 22 member 3 OS=Rattus norvegicus GN=Slc22a3 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 7.953e-14
Identity = 57/181 (31.49%), Postives = 98/181 (54.14%), Query Frame = -1
Query:  242 TCTIVLLTEKVGTEWRGLVGILDSFFFTIGTLTLPAIAYTNRSSSWTIIYLWTSIPTLVYSGLLYIFVSESPRWLFMQGRQEEAVEVIKSLSPIKDSNQLSLSLVSAVSFGHEPAAXXXXXXXXXSIRELFVRRWALERTLALMVLGFGIGVVYYGMTLGIENLGFDIYLGVVFNALLEIP 784
            TC  V++TE VG++ R +VGI+   FFT+G + LP IAY   + SW  I L  S+P+ ++  L Y  V ESPRWL  + + E+A+++++ ++  K + +   S  S ++   E  +          +R   +R+     TL LM   F   VVY G+ + +  +G ++Y+    + L+E+P
Sbjct:  220 TC-FVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYF--TPSWQGIQLAISLPSFLFL-LYYWVVPESPRWLITRKQGEKALQILRRVA--KCNGKHLSSNYSEITVTDEEVS---NPSCLDLVRTPQMRKC----TLILMFAWFTSAVVYQGLVMRLGLIGGNLYMDFFISGLVELP 387          
BLAST of CX069370 vs. ExPASy Swiss-Prot
Match: S22A3_MOUSE (Solute carrier family 22 member 3 OS=Mus musculus GN=Slc22a3 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 7.953e-14
Identity = 57/181 (31.49%), Postives = 98/181 (54.14%), Query Frame = -1
Query:  242 TCTIVLLTEKVGTEWRGLVGILDSFFFTIGTLTLPAIAYTNRSSSWTIIYLWTSIPTLVYSGLLYIFVSESPRWLFMQGRQEEAVEVIKSLSPIKDSNQLSLSLVSAVSFGHEPAAXXXXXXXXXSIRELFVRRWALERTLALMVLGFGIGVVYYGMTLGIENLGFDIYLGVVFNALLEIP 784
            TC  V++TE VG++ R +VGI+   FFT+G + LP IAY   + SW  I L  S+P+ ++  L Y  V ESPRWL  + + E+A+++++ ++  K + +   S  S ++   E  +          +R   +R+     TL LM   F   VVY G+ + +  +G ++Y+    + L+E+P
Sbjct:  220 TC-FVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYF--TPSWQGIQLAISLPSFLFL-LYYWVVPESPRWLITRKQGEKALQILRRVA--KCNGKHLSSNYSEITVTDEEVS---NPSCLDLVRTPQMRKC----TLILMFAWFTSAVVYQGLVMRLGLIGGNLYIDFFISGLVELP 387          
BLAST of CX069370 vs. ExPASy Swiss-Prot
Match: S22AF_XENTR (Solute carrier family 22 member 15 OS=Xenopus tropicalis GN=slc22a15 PE=2 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 2.314e-13
Identity = 67/245 (27.35%), Postives = 98/245 (40.00%), Query Frame = -1
Query:   74 GISRATIGTCTIVLLTEKVGTEWRGLVGILDSFFFTIGTLTLPAIAYTNRSSSWTIIYLWTSIPTLVYSGLLYIFVSESPRWLFMQGRQEEAVEVIKSLSPIKDSNQLSLSLVSAVSFGHEPAAXXXXXXXXXSIRELFVRRWALERTLALMVLGFGIGVVYYGMTLGIENLGFDIYLGVVFNALLEIPVWGIYFDKTSHDEQVSDSRIPRTGIFCRSQVAGEHEQEYSACSRMYPPRGHSGSRP 808
            G+    +     VLL E +G  +    G L S  F +G      I Y  RS  W ++ L  ++       L  + + ESPRWL  QGR  EA E + SL         S +L          A          +I  ++      +RTL +M + F   +VYYG+TL   +LG DIYL +  + L E+P + +     +H       R+ R G        G       AC  +    G +GS P
Sbjct:  163 GVMNGGMSLVAFVLLNECIGASYWAAAGSLGSLCFAVGIAQFALIGYFIRS--WRLLALLVNVQGAAVLALS-LCIPESPRWLHAQGRLREAQESLLSLGRRNRRKVTSFTLCPRQKDSAHSA----------NILTIYSNAILRQRTLIMMWVWFVCSLVYYGLTLSSGDLGGDIYLNLALSGLAELPAYPLCMYLINH------KRVGRRGSLAGFLCVGG-----GACLLIMLVPGKTGSGP 383          
BLAST of CX069370 vs. ExPASy Swiss-Prot
Match: S22AF_XENLA (Solute carrier family 22 member 15 OS=Xenopus laevis GN=slc22a15 PE=2 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 5.155e-13
Identity = 56/200 (28.00%), Postives = 87/200 (43.50%), Query Frame = -1
Query:  209 GISRATIGTCTIVLLTEKVGTEWRGLVGILDSFFFTIGTLTLPAIAYTNRSSSWTIIYLWTSIPTLVYSGLLYIFVSESPRWLFMQGRQEEAVEVIKSLSPIKDSNQLSLSLVSAVSFGHEPAAXXXXXXXXXSIRELFVRRWALERTLALMVLGFGIGVVYYGMTLGIENLGFDIYLGVVFNALLEIPVWGIYFDKTSH 808
            G+    +     VLL E +G+ +  + G L S  F +G      I Y  RS  W ++ +  ++       L  + + ESPRWL+ QGR  EA E + SL         S +L          A          +I  ++       RTL +M + F   +VYYG+TL   +LG DIYL +  + L E+P + +     +H
Sbjct:  163 GVMNGGMSLVAFVLLNECIGSSYWAIAGSLGSMCFAVGIAQFALIGYFIRS--WRLLAVLVNVQGAGVLALS-LCIPESPRWLYAQGRLHEAQESLVSLGRRNRKKFTSFTLRPRQKDSTHSA----------NIITIYSNSILRHRTLVMMWVWFVCSLVYYGLTLSSGDLGGDIYLNLALSGLAELPAYPLCMYLINH 349          
BLAST of CX069370 vs. ExPASy Swiss-Prot
Match: S22A1_MOUSE (Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=2 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 5.155e-13
Identity = 53/180 (29.44%), Postives = 86/180 (47.78%), Query Frame = -1
Query:  242 LLTEKVGTEWRGLVGILDSFFFTIGTLTLPAIAYTNRSSSWTIIYLWTSIPTLVYSGLLYIFVSESPRWLFMQGRQEEAVEVIKSLSP----IKDSNQLSLSLVSAVSFGHEPAAXXXXXXXXXSIRELFVRRWALERTLALMVLGFGIGVVYYGMTLGIENLGFDIYLGVVFNALLEIP 769
            L+TE VG+ +R    IL    FT+G + L  +AY      W  + L  S+PT ++  L Y FV ESPRWL  Q R  +AV +++ ++     +  ++   + L    S    P+             +LF      + TL LM L F   V+Y G+ + +   G ++YL   +++L+E P
Sbjct:  224 LITEFVGSGYRRTTAILYQVAFTVGLVGLAGVAYA--IPDWRWLQLAVSLPTFLFL-LYYWFVPESPRWLLSQKRTTQAVRIMEQIAQKNRKVPPADLKMMCLEEDASERRSPS-----------FADLFRTPSLRKHTLILMYLWFSCAVLYQGLIMHVGATGANLYLDFFYSSLVEFP 389          
BLAST of CX069370 vs. ExPASy Swiss-Prot
Match: S22A1_RAT (Solute carrier family 22 member 1 OS=Rattus norvegicus GN=Slc22a1 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.148e-12
Identity = 53/180 (29.44%), Postives = 85/180 (47.22%), Query Frame = -1
Query:  242 LLTEKVGTEWRGLVGILDSFFFTIGTLTLPAIAYTNRSSSWTIIYLWTSIPTLVYSGLLYIFVSESPRWLFMQGRQEEAVEVIKSLSP----IKDSNQLSLSLVSAVSFGHEPAAXXXXXXXXXSIRELFVRRWALERTLALMVLGFGIGVVYYGMTLGIENLGFDIYLGVVFNALLEIP 769
            L+TE VG+ +R    IL    FT+G + L  +AY      W  + L  S+PT ++  L Y FV ESPRWL  Q R   AV +++ ++     +  ++   L L    S    P+             +LF      + T+ LM L F   V+Y G+ + +   G ++YL   +++L+E P
Sbjct:  224 LITEFVGSGYRRTTAILYQMAFTVGLVGLAGVAYA--IPDWRWLQLAVSLPTFLFL-LYYWFVPESPRWLLSQKRTTRAVRIMEQIAQKNGKVPPADLKMLCLEEDASEKRSPS-----------FADLFRTPNLRKHTVILMYLWFSCAVLYQGLIMHVGATGANLYLDFFYSSLVEFP 389          
BLAST of CX069370 vs. ExPASy Swiss-Prot
Match: S22A3_HUMAN (Solute carrier family 22 member 3 OS=Homo sapiens GN=SLC22A3 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.500e-12
Identity = 54/186 (29.03%), Postives = 99/186 (53.23%), Query Frame = -1
Query:  242 RATIGTCTIVLLTEKVGTEWRGLVGILDSFFFTIGTLTLPAIAYTNRSSSWTIIYLWTSIPTLVYSGLLYIFVSESPRWLFMQGRQEEAVEVIKSLSPIKDSNQLSLSLVSAVSFGHEPAAXXXXXXXXXSIRELFVRRWALERTLALMVLGFGIGVVYYGMTLGIENLGFDIYLGVVFNALLEIP 799
            + T  TC  V++TE VG++ R +VGI+   FFT+G + LP IAY     +W  I L  ++P+ ++  L Y  V ESPRWL  + + ++A+++++ ++  K + +   S  S ++   E  +          +R   +R+     TL LM   F   VVY G+ + +  +G ++Y+    + ++E+P
Sbjct:  220 KGTWMTC-YVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYF--IPNWQGIQLAITLPSFLFL-LYYWVVPESPRWLITRKKGDKALQILRRIA--KCNGKYLSSNYSEITVTDEEVS---NPSFLDLVRTPQMRKC----TLILMFAWFTSAVVYQGLVMRLGIIGGNLYIDFFISGVVELP 392          
BLAST of CX069370 vs. ExPASy Swiss-Prot
Match: S22A2_RABIT (Solute carrier family 22 member 2 OS=Oryctolagus cuniculus GN=SLC22A2 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.959e-12
Identity = 54/177 (30.51%), Postives = 85/177 (48.02%), Query Frame = -1
Query:  242 VLLTEKVGTEWRGLVGILDSFFFTIGTLTLPAIAYTNRSSSWTIIYLWTSIPTLVYSGLLYIFVSESPRWLFMQGRQEEAVEVIKSLSPIKDSNQLSLSLVSAVSFGHEPAAXXXXXXXXXSIRELFVRRWALERTLALMVLGFGIGVVYYGMTLGIENLGFDIYLGVVFNALLEIP 772
            +L+TE VG  +R  VGIL    FT+G L L  +AY      W  + L  ++P   +  L Y  + ESPRWL  Q +  +A+ +++ ++  K+   L +SL S  +   E             +R   +R+     T  LM   F   V+Y G+ + +   G DIYL   ++AL+E P
Sbjct:  222 ILITEFVGLNYRRTVGILYQVAFTVGLLVLAGVAYA--LPRWRWLQLTVTLPYFCFL-LYYWCIPESPRWLISQNKNAKAMRIMEHIAK-KNGKSLPVSLQSLRA--AEDVGEKLNPSFLDLVRTPQIRK----HTCILMYNWFTSSVLYQGLIMHLGLAGGDIYLDFFYSALVEFP 388          
The following BLAST results are available for this feature:
BLAST of CX069370 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
S22AF_MOUSE1.712e-1631.58Solute carrier family 22 member 15 OS=Mus musculus... [more]
S22AF_HUMAN1.110e-1531.05Solute carrier family 22 member 15 OS=Homo sapiens... [more]
S22A3_RAT7.953e-1431.49Solute carrier family 22 member 3 OS=Rattus norveg... [more]
S22A3_MOUSE7.953e-1431.49Solute carrier family 22 member 3 OS=Mus musculus ... [more]
S22AF_XENTR2.314e-1327.35Solute carrier family 22 member 15 OS=Xenopus trop... [more]
S22AF_XENLA5.155e-1328.00Solute carrier family 22 member 15 OS=Xenopus laev... [more]
S22A1_MOUSE5.155e-1329.44Solute carrier family 22 member 1 OS=Mus musculus ... [more]
S22A1_RAT1.148e-1229.44Solute carrier family 22 member 1 OS=Rattus norveg... [more]
S22A3_HUMAN1.500e-1229.03Solute carrier family 22 member 3 OS=Homo sapiens ... [more]
S22A2_RABIT1.959e-1230.51Solute carrier family 22 member 2 OS=Oryctolagus c... [more]

Pages

back to top
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-2cdna_library
Properties
Property NameValue
Genbank descriptionUCRCS08_10A08_g Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA clone UCRCS08-10A08-A16-1-4.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX069370 ID=CX069370|Name=CX069370|organism=Citrus sinensis|type=EST|length=808bp
GTCTCGCCAACCGTCATTGACCGGGTCTCCCCACCTCAACCTCTAGCAGG
AATGGTTTTATCCTCCTAGTAGGAGGTCGGCTCCCACTGTGGCCCCGTGG
AGGATACATTCGTGAACAAGCAGAATATTCCTGCTCGTGTTCACCTGCTA
CCTGACTTCTGCAGAATATACCTGTTCGCGGAATCCTGCTATCAGATACC
TGTTCATCATGGCTGGTCTTGTCGAAATATATCCCCCAAACAGGTATCTC
CAACAAAGCATTGAACACCACACCTAGATAGATGTCAAATCCCAAGTTTT
CAATCCCCAATGTCATGCCGTAATATACAACTCCAATGCCAAAACCAAGA
ACCATGAGTGCCAAAGTTCTTTCAAGTGCCCATCTCCTAACGAATAATTC
CCTGATGGATGATAAAAACGAGGATTCCTTGGATGAAGCTGCTGGTTCAT
GTCCAAAGGAGACTGCACTTACCAAGCTCAAGCTTAATTGATTTGAATCC
TTTATGGGCGAAAGGCTTTTAATAACTTCCACGGCTTCTTCTTGGCGGCC
TTGCATGAAAAGCCATCTAGGAGACTCACTAACGAAAATATAAAGCAACC
CACTGTAGACAAGTGTCGGAATCGAAGTCCATAAATAGATAATTGTCCAT
GAAGAGCTTCGATTTGTATAAGCAATTGCCGGCAATGTTAATGTACCTAT
AGTGAAGAAGAAGGAATCCAAAATTCCGACAAGGCCTCGCCACTCTGTCC
CAACTTTCTCCGTTAGTAACACGATAGTACATGTTCCAATCGTGGCTCGG
CTAATCCC
back to top