CX069358

Overview
NameCX069358
Unique NameCX069358
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length870
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3928 contig Csv1_Contig3928:7..876. BLAST: Citrus Unigene V1 Contigs to TAIR9
Homology
BLAST of CX069358 vs. ExPASy Swiss-Prot
Match: ATP9_ARATH (ATP synthase subunit 9, mitochondrial OS=Arabidopsis thaliana GN=ATP9 PE=2 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 3.373e-21
Identity = 57/81 (70.37%), Postives = 59/81 (72.84%), Query Frame = 3
Query:  453 MKKRDENSQPEMLEGAKLMXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI 695
            M KR+ NSQPEMLEGAKL+                 NVFSSLIHSVARNPSLAKQ FGYAILGFALTEAIA FA MMAFLI
Sbjct:    1 MTKREYNSQPEMLEGAKLIGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLI 81          
BLAST of CX069358 vs. ExPASy Swiss-Prot
Match: ATP9_MALDO (ATP synthase subunit 9, mitochondrial OS=Malus domestica GN=ATP9 PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.672e-18
Identity = 51/70 (72.86%), Postives = 52/70 (74.29%), Query Frame = 3
Query:  486 MLEGAKLMXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI 695
            MLEGAK +                 NVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI
Sbjct:    1 MLEGAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI 70          
BLAST of CX069358 vs. ExPASy Swiss-Prot
Match: ATP9_BRANA (ATP synthase subunit 9, mitochondrial OS=Brassica napus GN=ATP9 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.326e-17
Identity = 50/70 (71.43%), Postives = 51/70 (72.86%), Query Frame = 3
Query:  486 MLEGAKLMXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI 695
            MLEGAK +                 NVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIA FAPMMAFLI
Sbjct:    1 MLEGAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFAPMMAFLI 70          
BLAST of CX069358 vs. ExPASy Swiss-Prot
Match: ATP9_TOBAC (ATP synthase subunit 9, mitochondrial OS=Nicotiana tabacum GN=ATP9 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.583e-17
Identity = 50/70 (71.43%), Postives = 50/70 (71.43%), Query Frame = 3
Query:  486 MLEGAKLMXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI 695
            MLEGAKLM                 NVFSSLIHSVARNPSLAKQ FGYAILGFALTEAIA FA MMAFLI
Sbjct:    1 MLEGAKLMGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLI 70          
BLAST of CX069358 vs. ExPASy Swiss-Prot
Match: ATP9_SOLTU (ATP synthase subunit 9, mitochondrial OS=Solanum tuberosum GN=ATP9 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.583e-17
Identity = 50/70 (71.43%), Postives = 50/70 (71.43%), Query Frame = 3
Query:  486 MLEGAKLMXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI 695
            MLEGAKLM                 NVFSSLIHSVARNPSLAKQ FGYAILGFALTEAIA FA MMAFLI
Sbjct:    1 MLEGAKLMGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLI 70          
BLAST of CX069358 vs. ExPASy Swiss-Prot
Match: ATP9_SOLLC (ATP synthase subunit 9, mitochondrial OS=Solanum lycopersicum GN=ATP9 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.583e-17
Identity = 50/70 (71.43%), Postives = 50/70 (71.43%), Query Frame = 3
Query:  486 MLEGAKLMXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI 695
            MLEGAKLM                 NVFSSLIHSVARNPSLAKQ FGYAILGFALTEAIA FA MMAFLI
Sbjct:    1 MLEGAKLMGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLI 70          
BLAST of CX069358 vs. ExPASy Swiss-Prot
Match: ATP9_PETHY (ATP synthase subunit 9, mitochondrial OS=Petunia hybrida GN=ATP9 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.583e-17
Identity = 50/70 (71.43%), Postives = 50/70 (71.43%), Query Frame = 3
Query:  486 MLEGAKLMXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI 695
            MLEGAKLM                 NVFSSLIHSVARNPSLAKQ FGYAILGFALTEAIA FA MMAFLI
Sbjct:    1 MLEGAKLMGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLI 70          
BLAST of CX069358 vs. ExPASy Swiss-Prot
Match: ATP9_OENBI (ATP synthase subunit 9, mitochondrial OS=Oenothera biennis GN=ATP9 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.583e-17
Identity = 50/70 (71.43%), Postives = 50/70 (71.43%), Query Frame = 3
Query:  486 MLEGAKLMXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI 695
            MLEGAKLM                 NVFSSLIHSVARNPSLAKQ FGYAILGFALTEAIA FA MMAFLI
Sbjct:    1 MLEGAKLMGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLI 70          
BLAST of CX069358 vs. ExPASy Swiss-Prot
Match: ATP9_HELAN (ATP synthase subunit 9, mitochondrial OS=Helianthus annuus GN=ATP9 PE=3 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 6.583e-17
Identity = 49/70 (70.00%), Postives = 50/70 (71.43%), Query Frame = 3
Query:  486 MLEGAKLMXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI 695
            MLEGAK +                 NV SS IHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI
Sbjct:    1 MLEGAKSIGAGAATIASAGAAIGIGNVLSSSIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI 70          
BLAST of CX069358 vs. ExPASy Swiss-Prot
Match: ATP9_WHEAT (ATP synthase subunit 9, mitochondrial OS=Triticum aestivum GN=ATP9 PE=1 SV=3)

HSP 1 Score: 86.6557 bits (213), Expect = 1.915e-16
Identity = 49/70 (70.00%), Postives = 50/70 (71.43%), Query Frame = 3
Query:  486 MLEGAKLMXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI 695
            MLEGAKL+                 NVFSSLIHSVARNPSLAKQ FGYAILGFALTEAIA FA MMAFLI
Sbjct:    1 MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLI 70          
The following BLAST results are available for this feature:
BLAST of CX069358 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
ATP9_ARATH3.373e-2170.37ATP synthase subunit 9, mitochondrial OS=Arabidops... [more]
ATP9_MALDO2.672e-1872.86ATP synthase subunit 9, mitochondrial OS=Malus dom... [more]
ATP9_BRANA1.326e-1771.43ATP synthase subunit 9, mitochondrial OS=Brassica ... [more]
ATP9_TOBAC6.583e-1771.43ATP synthase subunit 9, mitochondrial OS=Nicotiana... [more]
ATP9_SOLTU6.583e-1771.43ATP synthase subunit 9, mitochondrial OS=Solanum t... [more]
ATP9_SOLLC6.583e-1771.43ATP synthase subunit 9, mitochondrial OS=Solanum l... [more]
ATP9_PETHY6.583e-1771.43ATP synthase subunit 9, mitochondrial OS=Petunia h... [more]
ATP9_OENBI6.583e-1771.43ATP synthase subunit 9, mitochondrial OS=Oenothera... [more]
ATP9_HELAN6.583e-1770.00ATP synthase subunit 9, mitochondrial OS=Helianthu... [more]
ATP9_WHEAT1.915e-1670.00ATP synthase subunit 9, mitochondrial OS=Triticum ... [more]

Pages

back to top
Libraries
Library NameType
Parent Washington Navel Orange Callus cDNA Library UCRCS08-2cdna_library
Properties
Property NameValue
Genbank descriptionUCRCS08_10A01_b Parent Washington Navel Orange Callus cDNA Library UCRCS08-2 Citrus sinensis cDNA clone UCRCS08-10A01-A2-1-5.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX069358 ID=CX069358|Name=CX069358|organism=Citrus sinensis|type=EST|length=870bp
CTGCTATGCTTTAGCGTATCATCAGGGCAAGGCTTACTAATCGGCTCGAT
CTTTATCGTAATCGTATAAAGAAGAACTGGCCTCGCGTCAGATATTGGTT
GCGCGGATCGGCGGCTTGCAACATCACATCTGGAACGACCGATCTATGAA
TCTAAAGCTTTACGCGTAGAAAGACGTCCAGAAAGCTTGAATAAGATTGT
TTCATTTTTCTACGAAAAAGAAATCTTTCAGAATTCTGAAAGAGTCTTTC
ACTCATGCATTTCCTTTGCGGCAAGAAGAAGACATTGTTGATGCAGTTGC
GCACATTTTTTCTTTTTTTTTTCGTCGAGATTGGGTTGGTGTTCAGTGCC
GTGGGTACAAGATCGAAAAGACGTGGGCAAACCAAGTACGATGCCCAAGA
GAAAAGGAACGAGGGGAAGAATCGACGAGAAATCCATAACAAAAAATCGT
GAATGAAAAAGCGTGACGAGAATTCTCAACCCGAGATGTTAGAAGGTGCA
AAATTAATGGGTGCCGGAGCTGCTACAATTGCTTCAGCGGGAGCTGCTGT
CGGTATTGGAAACGTGTTCAGTTCTTTGATCCATTCCGTGGCACGAAATC
CATCATTGGCTAAACAATCATTTGGTTATGCCATTTTGGGCTTTGCTCTA
ACCGAAGCTATTGCATCGTTTGCCCCAATGATGGCCTTTTTGATCTCATT
CGTCTTCCGATCTAAGAAAGAAAAGAAGGTTTCAGTCTCATAAAGCAAGA
CCTCTTTCACATAAGAAAGTGGAGGCGGGCTTGGGTACGATCTAAAACGA
TTCCACATGAAAGAGGACTGCCCTCTTGAGTAATGGGAAGCGGGCTAGTC
CCCGAAAATGCTCGTTCCGA
back to top