DR403426

Overview
NameDR403426
Unique NameDR403426
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length750
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig160 contig Csv1_Contig160:1051..1800. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403426 vs. ExPASy Swiss-Prot
Match: DCS3_GOSAR ((+)-delta-cadinene synthase isozyme A OS=Gossypium arboreum GN=CAD1-A PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.401e-38
Identity = 75/177 (42.37%), Postives = 115/177 (64.97%), Query Frame = 2
Query:   86 KVIGAYSVQAKWFSEGYVPTIEEYMPIALTSCAYTFVITNSFLGMGDFATKEVFEWISNNPKVVKAASVICRLMGDMQGHEFEQKRGHVASAIECYTKQHGVSKEEAIKMFEEEVANAWKDINEELMMKPTVVARPLLGTILNLARAIDFIYKEDDGYTH-SYLIKDQIASVLGDHV 613
            +++ AY ++AKW  + Y PT EE+   AL +  Y  +   +F+GMG+  T E F+W +++PK++KA+++ICR M D+  H+F  +R    SAIECY KQ+GV+ +EA   F + + ++WKD+NEE  +KPT +  P+L   LNLAR +D +Y+E DGYTH     K  I S+L D +
Sbjct:  378 RLVQAYLLEAKWTHQNYKPTFEEFRDNALPTSGYAMLAITAFVGMGEVITPETFKWAASDPKIIKASTIICRFMDDIAEHKFNHRREDDCSAIECYMKQYGVTAQEAYNEFNKHIESSWKDVNEE-FLKPTEMPTPVLCRSLNLARVMDVLYREGDGYTHVGKAAKGGITSLLIDPI 553          
BLAST of DR403426 vs. ExPASy Swiss-Prot
Match: DCS4_GOSAR ((+)-delta-cadinene synthase isozyme C2 OS=Gossypium arboreum GN=CAD1-C2 PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 9.080e-38
Identity = 69/156 (44.23%), Postives = 106/156 (67.95%), Query Frame = 2
Query:   98 AYSVQAKWFSEGYVPTIEEYMPIALTSCAYTFVITNSFLGMGDFATKEVFEWISNNPKVVKAASVICRLMGDMQGHEFEQKRGHVASAIECYTKQHGVSKEEAIKMFEEEVANAWKDINEELMMKPTVVARPLLGTILNLARAIDFIYKEDDGYTH 565
            +Y V+A+W  + Y P+ EE+   AL +C Y  +   SF+GMGD  T E F+W +N+PK+++A+++ICR M D+  H+F+ +R    SAIECY +++GVS +EA  +F + V +AWKD+N+E   KPT +   +L   LNLAR +D +Y+E DGYT+
Sbjct:  381 SYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDIVTPETFKWAANDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVSAQEAYDVFNKHVESAWKDVNQE-FQKPTEMPTEVLNRSLNLARVMDVLYREGDGYTY 535          
BLAST of DR403426 vs. ExPASy Swiss-Prot
Match: HUMS_ARATH (Alpha-humulene/(-)-(E)-beta-caryophyllene synthase OS=Arabidopsis thaliana GN=TPS21 PE=2 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 1.186e-37
Identity = 76/178 (42.70%), Postives = 113/178 (63.48%), Query Frame = 2
Query:   83 QKVIGAYSVQAKWFSEGYVPTIEEYMPIALTSCAYTFVITNSFLGMGDFATKEVFEWISNNPKVVKAASVICRLMGDMQGHEFEQKRGHVASAIECYTKQHGVSKEEAIKMFEEEVANAWKDINEELMMKPTVVARPLLGTILNLARAIDFIYKEDDGYTHSYLIKDQIASVLGDHVP 616
            QK    Y  +AKW  + Y+ T +EY   A+ S  Y  +I  +F+ M D A  + FEW+S++PK+  A+ +I R   D+  +EFE KR HVA+ I+CY +Q GVSKE A+++    V++AWKD+N+EL M+P V   PLL  +LNL+R ID  Y+  D YT+  L+K+ I S+L + +P
Sbjct:  370 QKTANGYMQEAKWLKKDYIATFDEYKENAILSSGYYALIAMTFVRMTDVAKLDAFEWLSSHPKIRVASEIISRFTDDISSYEFEHKREHVATGIDCYMQQFGVSKERAVEVMGNIVSDAWKDLNQEL-MRPHVFPFPLLMRVLNLSRVIDVFYRYQDAYTNPKLLKEHIVSLLIETIP 546          
BLAST of DR403426 vs. ExPASy Swiss-Prot
Match: DCS2_GOSAR ((+)-delta-cadinene synthase isozyme XC14 OS=Gossypium arboreum PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.549e-37
Identity = 68/156 (43.59%), Postives = 107/156 (68.59%), Query Frame = 2
Query:   98 AYSVQAKWFSEGYVPTIEEYMPIALTSCAYTFVITNSFLGMGDFATKEVFEWISNNPKVVKAASVICRLMGDMQGHEFEQKRGHVASAIECYTKQHGVSKEEAIKMFEEEVANAWKDINEELMMKPTVVARPLLGTILNLARAIDFIYKEDDGYTH 565
            +Y V+A+W  + Y P+ EE+   AL +C Y  +   SF+GMGD  T E F+W +N+PK+++A+++ICR M D+  H+F+ +R    SAIECY +++GV+ +EA  +F + V +AWKD+N+E  +KPT +   +L   LNLAR +D +Y+E DGYT+
Sbjct:  381 SYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDIVTPETFKWAANDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVTAQEAYDVFNKHVESAWKDVNKE-FLKPTEMPTEVLNRSLNLARVMDVLYREGDGYTY 535          
BLAST of DR403426 vs. ExPASy Swiss-Prot
Match: DCS1_GOSAR ((+)-delta-cadinene synthase isozyme XC1 OS=Gossypium arboreum PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.642e-37
Identity = 68/156 (43.59%), Postives = 107/156 (68.59%), Query Frame = 2
Query:   98 AYSVQAKWFSEGYVPTIEEYMPIALTSCAYTFVITNSFLGMGDFATKEVFEWISNNPKVVKAASVICRLMGDMQGHEFEQKRGHVASAIECYTKQHGVSKEEAIKMFEEEVANAWKDINEELMMKPTVVARPLLGTILNLARAIDFIYKEDDGYTH 565
            +Y V+AKW  + Y P+ EE+   AL +C Y  +   SF+GMGD  T E F+W +++PK+++A+++ICR M D+  H+F+ +R    SAIECY +++GV+ +EA  +F + V +AWKD+N+E  +KPT +   +L   LNLAR +D +Y+E DGYT+
Sbjct:  381 SYLVEAKWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDIVTPETFKWAASDPKIIQASTIICRFMDDVAEHKFKHRREDDCSAIECYMEEYGVTAQEAYDVFNKHVESAWKDLNQE-FLKPTEMPTEVLNRSLNLARVMDVLYREGDGYTY 535          
BLAST of DR403426 vs. ExPASy Swiss-Prot
Match: DCS1_GOSHI ((+)-delta-cadinene synthase OS=Gossypium hirsutum GN=CDN1 PE=1 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 7.687e-37
Identity = 67/156 (42.95%), Postives = 106/156 (67.95%), Query Frame = 2
Query:   98 AYSVQAKWFSEGYVPTIEEYMPIALTSCAYTFVITNSFLGMGDFATKEVFEWISNNPKVVKAASVICRLMGDMQGHEFEQKRGHVASAIECYTKQHGVSKEEAIKMFEEEVANAWKDINEELMMKPTVVARPLLGTILNLARAIDFIYKEDDGYTH 565
            +Y V+A+W  + Y P+ EE+   AL +C Y  +   SF+GMGD  T E F+W +N+PK+++A+++ICR M D+  H+F+ +R    SAIECY +++GV+ +EA  +F + V +AWKD+N+   +KPT +   +L   LNLAR +D +Y+E DGYT+
Sbjct:  381 SYLVEARWTLQNYKPSFEEFKANALPTCGYAMLAITSFVGMGDIVTPETFKWAANDPKIIQASTIICRFMDDVTEHKFKHRREDDCSAIECYMEEYGVTAQEAYDVFNKHVESAWKDVNQG-FLKPTEMPTEVLNRSLNLARVMDVLYREGDGYTY 535          
BLAST of DR403426 vs. ExPASy Swiss-Prot
Match: 5EAS_TOBAC (Aristolochene synthase OS=Nicotiana tabacum GN=EAS3 PE=1 SV=3)

HSP 1 Score: 148.288 bits (373), Expect = 4.218e-35
Identity = 74/179 (41.34%), Postives = 117/179 (65.36%), Query Frame = 2
Query:   83 QKVIGAYSVQAKWFSEGYVPTIEEYMPIALTSCAYTFVITNSFLGMGDFATKEVFEWISNNPKVVKAASVICRLMGDMQGHEFEQKRGHVASAIECYTKQHGVSKEEAIKMFEEEVANAWKDINEELMMKPTVVARPLLGTILNLARAIDFIYKED-DGYTH-SYLIKDQIASVLGDHV 613
            ++V+  Y+V++ WF EGY P + EY+  AL +  Y ++ T S+LGM   AT++ FEW+S NPK+++A+ +ICR++ D   +E E+ RG +A+ IEC  + +G+S +EA+  F+     AWKDINE L ++PT V+   L  ILNLAR ++  Y  + DGYTH   ++K  I ++L D +
Sbjct:  370 KEVVRNYNVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKS-ATEQDFEWLSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQNMAETAWKDINEGL-LRPTPVSTEFLTPILNLARIVEVTYIHNLDGYTHPEKVLKPHIINLLVDSI 546          
BLAST of DR403426 vs. ExPASy Swiss-Prot
Match: CASS_RICCO (Casbene synthase, chloroplastic OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 9.724e-32
Identity = 67/177 (37.85%), Postives = 103/177 (58.19%), Query Frame = 2
Query:   83 QKVIGAYSVQAKWFSEGYVPTIEEYMPIALTSCAYTFVITNSFLGMGDFATKEVFEWISNNPKVVKAASVICRLMGDMQGHEFEQKRGHVASAIECYTKQHGVSKEEAIKMFEEEVANAWKDINEELMMKPTVVARPLLGTILNLARAIDFIYKEDDGYTHSYLIKDQIASVLGDHV 613
            Q+++  Y ++A W  EG +P+ ++Y+     +     V T SF+G+ +      F+W+  NPK+  A+    RL+ D+  H  EQ+RGHVAS I+CY  QHGVSK+EA+K+ ++   + WK+INEE M +  V    L+  I+NLAR  D  YK  DGYT S  +K  +  +  D +
Sbjct:  424 QELVRGYYLEAVWRDEGKIPSFDDYLYNGSMTTGLPLVSTASFMGVQEITGLNEFQWLETNPKLSYASGAFIRLVNDLTSHVTEQQRGHVASCIDCYMNQHGVSKDEAVKILQKMATDCWKEINEECMRQSQVSVGHLM-RIVNLARLTDVSYKYGDGYTDSQQLKQFVKGLFVDPI 599          
BLAST of DR403426 vs. ExPASy Swiss-Prot
Match: ECS1_ARTAN (Epi-cedrol synthase OS=Artemisia annua GN=ECS1 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.695e-31
Identity = 61/161 (37.89%), Postives = 95/161 (59.01%), Query Frame = 2
Query:   83 QKVIGAYSVQAKWFSEGYVPTIEEYMPIALTSCAYTFVITNSFLGMGDFATKEVFEWISNNPKVVKAASVICRLMGDMQGHEFEQKRGHVASAIECYTKQHGVSKEEAIKMFEEEVANAWKDINEELMMKPTVVARPLLGTILNLARAIDFIYKEDDGYTH 565
            ++ + +Y  +A+W  E Y+PTIEE+  ++  S  Y   +   F  MGD    + FEW+  NP +V A  ++CR M D+  H+ EQ R HVAS IECY KQ   S+++A +   ++V +AWK+IN E M+    V   +   +LN +R++D +YK  D +TH
Sbjct:  368 KEAVQSYMTEARWAKEEYIPTIEEHTKVSYISIGYKLALVAGFACMGDVIADDSFEWVFTNPPLVNACCLLCRTMDDLGSHKGEQDRKHVASTIECYMKQFDASEQQAYESLNKKVEDAWKEINREFMITCKDVNIHVAMRVLNFSRSVDVLYKNKDHFTH 528          
BLAST of DR403426 vs. ExPASy Swiss-Prot
Match: AMS1_ARTAN (Amorpha-4,11-diene synthase OS=Artemisia annua GN=AMS1 PE=1 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 5.714e-24
Identity = 55/163 (33.74%), Postives = 95/163 (58.28%), Query Frame = 2
Query:  107 VQAKWFSEGYVPTIEEYMPIALTSCAYTFVITNSFLGMGDFATKEVFEWISNNPKVVKAASVICRLMGDMQGHEFEQKRGHVASAIECYTKQHGVSKEEAIKMFEEEVANAWKDINEELMMKPTVVARPLLGTILNLARAIDFIYKEDDGYT-----HSYLIK 580
            V+AKW +EG++PT EE+ P+ + +     + T  +LGM D  TKE  EW  + P + + + ++ R + D+  H+ EQ+R H +S++E Y K++ V++E A  +  +EV + WKDIN E +     + RPLL  ++ L + ++  Y   D +T     + +LIK
Sbjct:  376 VEAKWANEGHIPTTEEHDPVVIITGGANLLTTTCYLGMSDIFTKESVEWAVSAPPLFRYSGILGRRLNDLMTHKAEQERKHSSSSLESYMKEYNVNEEYAQTLIYKEVEDVWKDINREYLTTKN-IPRPLLMAVIYLCQFLEVQYAGKDNFTRMGDEYKHLIK 537          
The following BLAST results are available for this feature:
BLAST of DR403426 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 40
Match NameE-valueIdentityDescription
DCS3_GOSAR1.401e-3842.37(+)-delta-cadinene synthase isozyme A OS=Gossypium... [more]
DCS4_GOSAR9.080e-3844.23(+)-delta-cadinene synthase isozyme C2 OS=Gossypiu... [more]
HUMS_ARATH1.186e-3742.70Alpha-humulene/(-)-(E)-beta-caryophyllene synthase... [more]
DCS2_GOSAR1.549e-3743.59(+)-delta-cadinene synthase isozyme XC14 OS=Gossyp... [more]
DCS1_GOSAR2.642e-3743.59(+)-delta-cadinene synthase isozyme XC1 OS=Gossypi... [more]
DCS1_GOSHI7.687e-3742.95(+)-delta-cadinene synthase OS=Gossypium hirsutum ... [more]
5EAS_TOBAC4.218e-3541.34Aristolochene synthase OS=Nicotiana tabacum GN=EAS... [more]
CASS_RICCO9.724e-3237.85Casbene synthase, chloroplastic OS=Ricinus communi... [more]
ECS1_ARTAN3.695e-3137.89Epi-cedrol synthase OS=Artemisia annua GN=ECS1 PE=... [more]
AMS1_ARTAN5.714e-2433.74Amorpha-4,11-diene synthase OS=Artemisia annua GN=... [more]

Pages

back to top
Libraries
Library NameType
Flavedo Maturecdna_library
Properties
Property NameValue
Genbank descriptionCSAF-PNP1244P20 Flavedo Mature Citrus sinensis cDNA clone CSAF-PNP1244P20 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403426 ID=DR403426|Name=DR403426|organism=Citrus sinensis|type=EST|length=750bp
GGGGATATTAAAATTTAAAAACTTATTTCTTATTATTGTTTTTATAACGG
CTAAGGTTTAGCTGCGTTTTGCTTCTCAGAATCAAAAAGTAATTGGAGCA
TACTCTGTTCAAGCCAAATGGTTCAGTGAAGGTTACGTTCCAACAATTGA
GGAGTATATGCCTATTGCACTAACAAGTTGTGCTTACACATTCGTCATAA
CAAATTCCTTCCTTGGCATGGGTGATTTTGCAACTAAAGAGGTTTTTGAA
TGGATCTCCAATAACCCTAAGGTTGTAAAAGCAGCATCAGTTATCTGCAG
ACTCATGGGTGACATGCAAGGTCATGAGTTTGAGCAGAAGAGAGGACATG
TTGCGTCAGCTATTGAATGTTACACGAAGCAGCATGGTGTCTCTAAGGAA
GAGGCAATTAAAATGTTTGAAGAAGAAGTTGCAAATGCATGGAAAGATAT
TAACGAGGAGTTGATGATGAAGCCAACCGTCGTTGCCCGACCACTGCTCG
GGACGATTCTTAATCTTGCTCGTGCAATTGATTTTATTTACAAAGAGGAC
GACGGCTATACGCATTCTTACCTAATTAAAGATCAAATTGCTTCTGTGCT
AGGAGACCACGTTCCATTTTGACGACTAGTTCTATACTTCTATTAATAAT
ATTTTCAGTTCCTTGGTTTGTGTTTGAAGGAAATACGGTGTATCGTATTG
GTCTGTACTAATAAATATTTTATATTTTTATTGTTATTTAAAGATTTTCC
back to top