DR403413

Overview
NameDR403413
Unique NameDR403413
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length763
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9848 contig Csv1_Contig9848:9..771. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403413 vs. ExPASy Swiss-Prot
Match: G3OX4_ARATH (Gibberellin 3-beta-dioxygenase 4 OS=Arabidopsis thaliana GN=At1g80330 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.906e-22
Identity = 77/254 (30.31%), Postives = 125/254 (49.21%), Query Frame = 2
Query:   56 IPTIDLGEFPKQLKKLREASEEWGCFRVVNHKVSSTLMAEMKQVVRELLDLPLEIKRRNTDVIAG-SGYMAPTQKNPLYEALGLYDMASSQAVADFCSHLDAS-PHQRET----IEKYAQAIQELAVDLAHKLAESMGLMDSVFQDWPCQF------------RINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAGAFVPVDPLPGTLPVNLGDIATVWSNGRLLNVKHRVQCKESAIRVSI 763
            IP IDL   P     + +AS+ WG F++ NH +S  L+ +++ + + L D+P E K        G SGY  P + +P +E   ++    + A   + +H +   PH        I++Y   +++LA  L + +  S+G+     + W  +             R+N Y   PE   + G+  HTDS  LTIL    N GGL+V      +V V+P PG L VN+GD+  + SNG++ +V HR +   +  R+SI
Sbjct:   49 IPVIDLSN-PDVTTLIGDASKTWGAFQIANHGISQKLLDDIESLSKTLFDMPSERKLEAASSDKGVSGYGEP-RISPFFEKK-MWSEGFTIADDSYRNHFNTLWPHDHTKYCGIIQEYVDEMEKLASRLLYCILGSLGVTVEDIE-WAHKLEKSGSKVGRGAIRLNHYPVCPEPERAMGLAAHTDSTILTILHQS-NTGGLQVFREESGWVTVEPAPGVLVVNIGDLFHILSNGKIPSVVHRAKVNHTRSRISI 297          
BLAST of DR403413 vs. ExPASy Swiss-Prot
Match: G2OX8_ARATH (Gibberellin 2-beta-dioxygenase 8 OS=Arabidopsis thaliana GN=GA2OX7 PE=1 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 5.546e-22
Identity = 80/251 (31.87%), Postives = 120/251 (47.81%), Query Frame = 2
Query:   44 ERRRIPTIDLGEFPKQLKKLRE--------ASEEWGCFRVVNHKVSSTLMAEMKQVVRELLDLPLEIKRRNTDVIAGSGYMAPTQKNPLYEALGLYDMASSQAVADFCSHLDASPHQRETIEKYAQAIQELAVDLAHKLAESMGLMDSVFQD----WPCQFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAGAFVPVDPLPGTLPVNLGDIATVWSNGRLLNVKHRVQCKESAIRVS 760
            E   +P ID+       ++ RE        AS EWG F+V+NH +S  ++ +M+Q    +   P + K ++    AGS Y   T        L  +  A    + D   + D +     T+EK+A   + LA  LA  LAE  G   S F++      C  R+N+Y   P+     G+  HTDS FLTIL  D+ VGGL+++ +   ++ V P P  L +N+GD+   WSNG   +V+HRV       R S
Sbjct:   38 EEVELPVIDVSRLIDGAEEEREKCKEAIARASREWGFFQVINHGISMDVLEKMRQEQIRVFREPFDKKSKSEKFSAGS-YRWGTPSATSIRQLS-WSEAFHVPMTDISDNKDFTT-LSSTMEKFASESEALAYMLAEVLAEKSGQNSSFFKENCVRNTCYLRMNRYPPCPKPSEVYGLMPHTDSDFLTILYQDQ-VGGLQLI-KDNRWIAVKPNPKALIINIGDLFQAWSNGMYKSVEHRVMTNPKVERFS 283          
BLAST of DR403413 vs. ExPASy Swiss-Prot
Match: ACCH3_SOLLC (1-aminocyclopropane-1-carboxylate oxidase homolog OS=Solanum lycopersicum GN=ACO3 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.784e-20
Identity = 84/272 (30.88%), Postives = 133/272 (48.90%), Query Frame = 2
Query:   14 PDKQIKSEMEERRRIPTIDL---GEFPKQLK----KLREASEEWGCFRVVNHKVSSTLMAEMKQVVRELLDLPLEIKRRNTDVIAGSGYMAPTQKNPLYEA-LGLYDM---ASSQAVADFCSHLDASPHQR-------ETIEKYAQAIQELAVDLAHKLAESMGLMDSVFQDWPCQFRI----NKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAGAFVPVDPLPGTLPVNLGDIATVWSNGRLLNVKHRVQCKESAIRVSI 763
            P K    + E     P IDL    E P + K    K+R+ASE+WG F+VVNH + ++++    Q  R+  +   E+K++         Y   T K  +Y + L LY     A+S     FC      P  +       E++  +++ +++L   L   L+E +GL  S  +D+   F +    N Y   P+   + G   HTD GF+TIL  D+ +GGL+V+ +   +V V P PG+L VN+GD   + SN + L+V+HR        R+SI
Sbjct:   44 PPKDRAKKCETHFVFPVIDLQGIDEDPIKHKEIVDKVRDASEKWGFFQVVNHGIPTSVLDRTLQGTRQFFEQDNEVKKQY--------YTRDTAKKVVYTSNLDLYKSSVPAASWRDTIFCYMAPNPPSLQEFPTPCGESLIDFSKDVKKLGFTLLELLSEGLGLDRSYLKDYMDCFHLFCSCNYYPPCPQPELTMGTIQHTDIGFVTILLQDD-MGGLQVLHQ-NHWVDVPPTPGSLVVNIGDFLQLLSNDKYLSVEHRAISNNVGSRMSI 305          
BLAST of DR403413 vs. ExPASy Swiss-Prot
Match: SRG1_ARATH (Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.156e-19
Identity = 72/264 (27.27%), Postives = 131/264 (49.62%), Query Frame = 2
Query:   23 QIKSEMEERRRIPTIDLGEF------PKQLKKLREASEEWGCFRVVNHKVSSTLMAEMKQVVRELLDLPLEIKRR---NTDVIAGSGYMAPTQKNPLYEALGLYDMASSQAVADFCSHL--DASPHQRETIEKYAQAIQELAVDLAHKLAESMGL----MDSVFQDWPC--QFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAGAFVPVDPLPGTLPVNLGDIATVWSNGRLLNVKHRVQCKESAIRVSI 763
            ++  + + +  IP ID+           +++KL  A +EWG F++VNH + S+ + ++K  +++  +LP+E K++     D I G G      ++   +   L+   + Q V     HL        R+T+E Y+  +Q +A  L  K+A ++ +    ++ +F D       R+N Y   P+     G+  H+DS  LT+L    +V GL++  + G +VPV PLP    VN+GD+  + +NG   +++HR        R+SI
Sbjct:   42 EVDDDFDVKIEIPIIDMKRLCSSTTMDSEVEKLDFACKEWGFFQLVNHGIDSSFLDKVKSEIQDFFNLPMEEKKKFWQRPDEIEGFGQAFVVSEDQKLDWADLF-FHTVQPVELRKPHLFPKLPLPFRDTLEMYSSEVQSVAKILIAKMARALEIKPEELEKLFDDVDSVQSMRMNYYPPCPQPDQVIGLTPHSDSVGLTVLMQVNDVEGLQI-KKDGKWVPVKPLPNAFIVNIGDVLEIITNGTYRSIEHRGVVNSEKERLSI 303          
BLAST of DR403413 vs. ExPASy Swiss-Prot
Match: ACCH2_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 2 OS=Arabidopsis thaliana GN=At1g06640 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.973e-19
Identity = 75/269 (27.88%), Postives = 134/269 (49.81%), Query Frame = 2
Query:   20 KQIKSEMEERRRIPTIDLG--EFPKQLKK------LREASEEWGCFRVVNHKVSSTLMAEMKQVVRELLDLPLEIKRRNTDVIAGSGYMAPTQKNPLYEALGLYDMASSQAVADFCSHLDASPHQ--------RETIEKYAQAIQELAVDLAHKLAESMGLMDSVFQDWPC----QFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAGAFVPVDPLPGTLPVNLGDIATVWSNGRLLNVKHRVQC-KESAIRVSI 763
            K + S++   + IPTIDLG  +F   +K       ++EA+ +WG F+V+NH VS  L+ +MK  VR+  + P E+++       G  ++             LY  A++     F  ++   P +        R+ + +Y++ +  L   L   L+E++GL  +  +D  C    +   + +   PE   + G   H+D  FLT+L  D N+ GL+V  R G +  V  +PG L +N+GD+  + +N + +++KHRV   + +  RVS+
Sbjct:   52 KPLPSDLLHLKTIPTIDLGGRDFQDAIKHKNAIEGIKEAAAKWGFFQVINHGVSLELLEKMKDGVRDFHEQPPEVRKDLYSRDFGRKFI-------YLSNFDLYTAAAANWRDTFYCYMAPDPPEPQDLPEICRDVMMEYSKQVMILGEFLFELLSEALGLNPNHLKDMECLKGLRMLCHYFPPCPEPDLTFGTSKHSDGSFLTVLLPD-NIEGLQVC-REGYWFDVPHVPGALIINIGDLLQLITNDKFISLKHRVLANRATRARVSV 311          
BLAST of DR403413 vs. ExPASy Swiss-Prot
Match: FL3H_DIACA (Naringenin,2-oxoglutarate 3-dioxygenase OS=Dianthus caryophyllus GN=FHT PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.365e-19
Identity = 72/235 (30.64%), Postives = 111/235 (47.23%), Query Frame = 2
Query:   95 KKLREASEEWGCFRVVNHKVSSTLMAEMKQVVRELLDLPLEIKRRNTDVIAG-------SGYMAPTQKNPLYEALGLYDMASSQAVADFCSHLDASPHQRETIEKYAQAIQELAVDLAHKLAESMGL----MDSVFQDWPCQFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAG-AFVPVDPLPGTLPVNLGDIATVWSNGRLLNVKHRVQCKESAIRVSI 763
            +K+ EA E+WG F+VV+H V   L+A+M ++ RE   LP E K R  D+  G       S ++         E +  +   ++    D+    D      +  E+Y+  +  LA  L   L+E+MGL    +     D   +  +N Y   P+   + G++ HTD G +T+L  D+ VGGL+     G  ++ V P+PG   VNLGD     SNGR  N  H+        R+SI
Sbjct:   59 RKIVEACEDWGIFQVVDHGVGDDLIADMTRLAREFFALPAEEKLR-FDMSGGKKGGFIVSSHLQGEVVQDWREIVTYFSYPTNSR--DYTRWPDKPEGWIKVTEEYSNKLMTLACTLLGVLSEAMGLELEALTKACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDPGTITLLLQDQ-VGGLQATRDGGKTWITVQPVPGAFVVNLGDHGHFLSNGRFKNADHQAVVNSECSRLSI 289          
BLAST of DR403413 vs. ExPASy Swiss-Prot
Match: FNSI_PETCR (Flavone synthase OS=Petroselinum crispum GN=FNSI PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.395e-19
Identity = 77/240 (32.08%), Postives = 113/240 (47.08%), Query Frame = 2
Query:   74 GEFPKQLKKLREASEEWGCFRVVNHKVSSTLMAEMKQVVRELLDLPLEIKRRNTDVIAG--SGYMAPT--QKNPLYEALGLYDMASSQAVADFCSHLDASPH-QRETIEKYAQAIQELAVDLAHKLAESMGL----MDSVFQDWPCQFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLE-VMDRAGAFVPVDPLPGTLPVNLGDIATVWSNGRLLNVKHRVQCKESAIRVSI 763
            G  P+  +K+ +A E+WG F+VV+H + S L++EM ++ RE   LP E ++   D   G   G+   T  Q +   +        S    A   S     P   R T E Y++ +  L   L   L+E+MGL    +     D   +  IN Y   P+   + GV+ HTD G +TIL  D  VGGL+   D    ++ V P+ G   VNLGD     SNGR  N  H+     ++ R+SI
Sbjct:   52 GRRPEICRKIVKACEDWGIFQVVDHGIDSGLISEMTRLSREFFALPAE-EKLEYDTTGGKRGGFTISTVLQGDDAMDWREFVTYFSYPINARDYSRWPKKPEGWRSTTEVYSEKLMVLGAKLLEVLSEAMGLEKGDLTKACVDMEQKVLINYYPTCPQPDLTLGVRRHTDPGTITILLQD-MVGGLQATRDGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFRNADHQAVVNSTSSRLSI 289          
BLAST of DR403413 vs. ExPASy Swiss-Prot
Match: FL3H_PETCR (Flavanone 3-dioxygenase OS=Petroselinum crispum GN=FHT PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.670e-18
Identity = 72/234 (30.77%), Postives = 112/234 (47.86%), Query Frame = 2
Query:   95 KKLREASEEWGCFRVVNHKVSSTLMAEMKQVVRELLDLPLEIKRRNTDVIAGS--GYMAPTQKNPL----YEALGLYDMASSQAVADFCSHLDASPHQRETIEKYAQAIQELAVDLAHKLAESMGL----MDSVFQDWPCQFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLE-VMDRAGAFVPVDPLPGTLPVNLGDIATVWSNGRLLNVKHRVQCKESAIRVSI 763
            +K+ EA E+WG F+VV+H +   L++EM ++ R+   LP E K R  D+  G   G++  +         +  +  Y     QA  D+    D     R   E Y+  +  LA  L   L+E+MGL    +     D   +  +N Y   P+   + G++ HTD G +T+L  D+ VGGL+   D    ++ V P+ G   VNLGD     SNGR  N  H+     ++ R+SI
Sbjct:   59 RKIVEACEDWGIFQVVDHGIDIDLISEMTRLARQFFALPAEEKLR-FDMTGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPIQA-RDYSRWPDKPEGWRSITEMYSDELMALACKLLEVLSEAMGLEKEGLTKACVDMDQKVIVNYYPKCPQPNLTLGLKRHTDPGTITLLLQDQ-VGGLQATRDGGKTWITVQPVEGAFVVNLGDHGHYLSNGRFKNADHQAVVNSNSSRMSI 289          
BLAST of DR403413 vs. ExPASy Swiss-Prot
Match: FL3H_MALDO (Naringenin,2-oxoglutarate 3-dioxygenase OS=Malus domestica PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.670e-18
Identity = 72/235 (30.64%), Postives = 111/235 (47.23%), Query Frame = 2
Query:   95 KKLREASEEWGCFRVVNHKVSSTLMAEMKQVVRELLDLPLEIKRRNTDVIAG-------SGYMAPTQKNPLYEALGLYDMASSQAVADFCSHLDASPHQRETIEKYAQAIQELAVDLAHKLAESMGL----MDSVFQDWPCQFRINKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLE-VMDRAGAFVPVDPLPGTLPVNLGDIATVWSNGRLLNVKHRVQCKESAIRVSI 763
            KK+  A E+WG F++V+H V + L++EM  + RE   LP E K R  D+  G       S ++         E +  +         D+    D     RE  +KY+  +  LA  L   L+E+MGL    +     D   +  +N Y   P+   + G++ HTD G +T+L  D+ VGGL+   D    ++ V P+ G   VNLGD   + SNGR  N  H+     ++ R+SI
Sbjct:   59 KKIVAACEDWGIFQIVDHGVDAELISEMTGLAREFFALPSEEKLR-FDMSGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPIRHR--DYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAMGLDTEALTKACVDMDQKVVVNFYPKCPQPDLTLGLKRHTDPGTITLLLQDQ-VGGLQATRDDGKTWITVQPVEGAFVVNLGDHGHLLSNGRFKNADHQAVVNSNSSRLSI 289          
BLAST of DR403413 vs. ExPASy Swiss-Prot
Match: ACCH3_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 4 OS=Arabidopsis thaliana GN=At1g06650 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.181e-18
Identity = 77/275 (28.00%), Postives = 137/275 (49.82%), Query Frame = 2
Query:   11 SPDKQIKSEMEERRRIPTIDLG--EFPKQLKK------LREASEEWGCFRVVNHKVSSTLMAEMKQVVRELLDLPLEIKRRNTDVIAGSGYMAPTQKNPLYEALGLYDMASSQAV----ADFCSHLDASPHQ-------RETIEKYAQAIQELAVDLAHKLAESMGLMDSVFQDWPCQFRI----NKYNFAPESVGSPGVQLHTDSGFLTILQDDENVGGLEVMDRAGAFVPVDPLPGTLPVNLGDIATVWSNGRLLNVKHRVQC-KESAIRVSI 763
            S  K + S++   + IPTIDLG  +F   +K+      ++EA+ +WG F+V+NH VS  L+ +MK+ VR+  +   E+++          Y     +  LY  L  +D+ SS A        C+    +P         R+ + +Y++ +  L   L   L+E++GL  +   D  C   +    + Y   PE   + G   H+D+ FLT+L  D+ + GL+V  R G +  V  + G L +N+GD+  + +N + ++++HRV   + +  RVS+
Sbjct:   49 STPKPLPSDLLHLKTIPTIDLGGRDFQDAIKRNNAIEEIKEAAAKWGFFQVINHGVSLELLEKMKKGVRDFHEQSQEVRK--------EFYSRDFSRRFLY--LSNFDLFSSPAANWRDTFSCTMAPDTPKPQDLPEICRDIMMEYSKQVMNLGKFLFELLSEALGLEPNHLNDMDCSKGLLMLSHYYPPCPEPDLTLGTSQHSDNSFLTVLLPDQ-IEGLQVR-REGHWFDVPHVSGALIINIGDLLQLITNDKFISLEHRVLANRATRARVSV 311          
The following BLAST results are available for this feature:
BLAST of DR403413 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 66
Match NameE-valueIdentityDescription
G3OX4_ARATH1.906e-2230.31Gibberellin 3-beta-dioxygenase 4 OS=Arabidopsis th... [more]
G2OX8_ARATH5.546e-2231.87Gibberellin 2-beta-dioxygenase 8 OS=Arabidopsis th... [more]
ACCH3_SOLLC1.784e-2030.881-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
SRG1_ARATH1.156e-1927.27Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 ... [more]
ACCH2_ARATH1.973e-1927.881-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
FL3H_DIACA3.365e-1930.64Naringenin,2-oxoglutarate 3-dioxygenase OS=Dianthu... [more]
FNSI_PETCR4.395e-1932.08Flavone synthase OS=Petroselinum crispum GN=FNSI P... [more]
FL3H_PETCR1.670e-1830.77Flavanone 3-dioxygenase OS=Petroselinum crispum GN... [more]
FL3H_MALDO1.670e-1830.64Naringenin,2-oxoglutarate 3-dioxygenase OS=Malus d... [more]
ACCH3_ARATH2.181e-1828.001-aminocyclopropane-1-carboxylate oxidase homolog ... [more]

Pages

back to top
Libraries
Library NameType
Flavedo Maturecdna_library
Properties
Property NameValue
Genbank descriptionCSAF-PNP1244P03 Flavedo Mature Citrus sinensis cDNA clone CSAF-PNP1244P03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403413 ID=DR403413|Name=DR403413|organism=Citrus sinensis|type=EST|length=763bp
GGGGACGTATTCACCAGATAAACAAATAAAAAGTGAGATGGAGGAGAGGA
GAAGGATCCCGACGATAGATCTGGGGGAATTCCCGAAGCAGCTGAAGAAA
CTGAGAGAAGCAAGCGAGGAATGGGGATGCTTCAGGGTGGTGAACCACAA
GGTCTCGTCAACGCTGATGGCGGAAATGAAGCAAGTGGTGAGGGAGCTTT
TGGATCTTCCTCTCGAGATCAAACGACGCAACACCGATGTGATCGCCGGC
AGCGGCTACATGGCTCCCACCCAGAAGAATCCTCTGTATGAAGCTTTGGG
TCTCTACGACATGGCTTCTTCTCAAGCTGTTGCTGACTTTTGTTCTCACC
TGGATGCCTCTCCTCATCAGAGAGAGACAATAGAGAAATATGCTCAAGCA
ATACAAGAGTTGGCCGTGGATTTGGCGCATAAATTGGCCGAGAGTATGGG
GTTGATGGACAGTGTGTTCCAGGATTGGCCTTGCCAGTTTAGGATAAACA
AGTACAACTTCGCTCCAGAAAGCGTAGGCTCCCCTGGAGTGCAATTACAC
ACAGATTCAGGGTTCCTTACTATTCTTCAAGATGATGAAAATGTTGGTGG
CCTCGAAGTGATGGACAGAGCTGGTGCATTTGTACCTGTTGATCCCTTGC
CCGGCACCCTCCCTGTCAATCTTGGAGACATTGCCACGGTATGGAGTAAC
GGAAGGTTGCTCAATGTGAAGCATAGAGTGCAGTGCAAGGAATCAGCAAT
AAGAGTATCGATT
back to top