DR403410

Overview
NameDR403410
Unique NameDR403410
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length308
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13130 contig Csv1_Contig13130:1096..1403. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403410 vs. ExPASy Swiss-Prot
Match: ALEU_ARATH (Thiol protease aleurain OS=Arabidopsis thaliana GN=ALEU PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 2.094e-21
Identity = 43/46 (93.48%), Postives = 44/46 (95.65%), Query Frame = 1
Query:    4 GVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA 141
            GVEDGVPYWLIKNSWG +WGD GYFKMEMGKNMCGIATCASYPVVA
Sbjct:  313 GVEDGVPYWLIKNSWGADWGDKGYFKMEMGKNMCGIATCASYPVVA 358          
BLAST of DR403410 vs. ExPASy Swiss-Prot
Match: CYSP2_MAIZE (Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 2.735e-21
Identity = 41/46 (89.13%), Postives = 44/46 (95.65%), Query Frame = 1
Query:    4 GVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA 141
            GVEDGVPYWLIKNSWG +WGD GYFKMEMGKNMCG+ATCASYP+VA
Sbjct:  315 GVEDGVPYWLIKNSWGADWGDEGYFKMEMGKNMCGVATCASYPIVA 360          
BLAST of DR403410 vs. ExPASy Swiss-Prot
Match: ORYC_ORYSJ (Oryzain gamma chain OS=Oryza sativa subsp. japonica GN=Os09g0442300 PE=2 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 6.092e-21
Identity = 41/46 (89.13%), Postives = 45/46 (97.83%), Query Frame = 1
Query:    4 GVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA 141
            GVE+GVPYWLIKNSWG +WGD+GYFKMEMGKNMCGIATCASYP+VA
Sbjct:  317 GVENGVPYWLIKNSWGADWGDNGYFKMEMGKNMCGIATCASYPIVA 362          
BLAST of DR403410 vs. ExPASy Swiss-Prot
Match: ALEU_HORVU (Thiol protease aleurain OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.315e-20
Identity = 41/46 (89.13%), Postives = 44/46 (95.65%), Query Frame = 1
Query:    4 GVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA 141
            GVE+GVPYWLIKNSWG +WGD+GYFKMEMGKNMC IATCASYPVVA
Sbjct:  316 GVENGVPYWLIKNSWGADWGDNGYFKMEMGKNMCAIATCASYPVVA 361          
BLAST of DR403410 vs. ExPASy Swiss-Prot
Match: ALEUL_ARATH (Thiol protease aleurain-like OS=Arabidopsis thaliana GN=At3g45310 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.949e-20
Identity = 40/46 (86.96%), Postives = 43/46 (93.48%), Query Frame = 1
Query:    4 GVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA 141
            GVED VPYWLIKNSWG  WGD+GYFKMEMGKNMCG+ATC+SYPVVA
Sbjct:  313 GVEDDVPYWLIKNSWGGEWGDNGYFKMEMGKNMCGVATCSSYPVVA 358          
BLAST of DR403410 vs. ExPASy Swiss-Prot
Match: CYSP3_SOLLC (Cysteine proteinase 3 OS=Solanum lycopersicum GN=CYP-3 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.149e-19
Identity = 38/46 (82.61%), Postives = 43/46 (93.48%), Query Frame = 1
Query:    4 GVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA 141
            GVE+G PYWLIKNSWG +WG+ GYFKMEMGKNMCG+ATCASYP+VA
Sbjct:  311 GVENGTPYWLIKNSWGADWGEDGYFKMEMGKNMCGVATCASYPIVA 356          
BLAST of DR403410 vs. ExPASy Swiss-Prot
Match: CATH_PIG (Cathepsin H OS=Sus scrofa GN=CTSH PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.524e-15
Identity = 29/44 (65.91%), Postives = 37/44 (84.09%), Query Frame = 1
Query:    4 GVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPV 135
            G E+G+PYW++KNSWG  WG +GYF +E GKNMCG+A CASYP+
Sbjct:  289 GEENGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPI 332          
BLAST of DR403410 vs. ExPASy Swiss-Prot
Match: CATH_BOVIN (Cathepsin H OS=Bos taurus GN=CTSH PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.113e-14
Identity = 29/44 (65.91%), Postives = 36/44 (81.82%), Query Frame = 1
Query:    4 GVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPV 135
            G E G+PYW++KNSWG NWG  GYF +E GKNMCG+A CAS+P+
Sbjct:  289 GEEKGIPYWIVKNSWGPNWGMKGYFLIERGKNMCGLAACASFPI 332          
BLAST of DR403410 vs. ExPASy Swiss-Prot
Match: CATH_RAT (Cathepsin H OS=Rattus norvegicus GN=Ctsh PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.898e-14
Identity = 28/44 (63.64%), Postives = 38/44 (86.36%), Query Frame = 1
Query:    4 GVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPV 135
            G ++G+ YW++KNSWG NWG++GYF +E GKNMCG+A CASYP+
Sbjct:  287 GEQNGLLYWIVKNSWGSNWGNNGYFLIERGKNMCGLAACASYPI 330          
BLAST of DR403410 vs. ExPASy Swiss-Prot
Match: CATH_HUMAN (Cathepsin H OS=Homo sapiens GN=CTSH PE=1 SV=4)

HSP 1 Score: 77.7962 bits (190), Expect = 1.898e-14
Identity = 28/44 (63.64%), Postives = 37/44 (84.09%), Query Frame = 1
Query:    4 GVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPV 135
            G ++G+PYW++KNSWG  WG +GYF +E GKNMCG+A CASYP+
Sbjct:  289 GEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPI 332          
The following BLAST results are available for this feature:
BLAST of DR403410 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
ALEU_ARATH2.094e-2193.48Thiol protease aleurain OS=Arabidopsis thaliana GN... [more]
CYSP2_MAIZE2.735e-2189.13Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=... [more]
ORYC_ORYSJ6.092e-2189.13Oryzain gamma chain OS=Oryza sativa subsp. japonic... [more]
ALEU_HORVU2.315e-2089.13Thiol protease aleurain OS=Hordeum vulgare PE=2 SV... [more]
ALEUL_ARATH3.949e-2086.96Thiol protease aleurain-like OS=Arabidopsis thalia... [more]
CYSP3_SOLLC1.149e-1982.61Cysteine proteinase 3 OS=Solanum lycopersicum GN=C... [more]
CATH_PIG6.524e-1565.91Cathepsin H OS=Sus scrofa GN=CTSH PE=1 SV=1[more]
CATH_BOVIN1.113e-1465.91Cathepsin H OS=Bos taurus GN=CTSH PE=2 SV=1[more]
CATH_RAT1.898e-1463.64Cathepsin H OS=Rattus norvegicus GN=Ctsh PE=1 SV=1[more]
CATH_HUMAN1.898e-1463.64Cathepsin H OS=Homo sapiens GN=CTSH PE=1 SV=4[more]

Pages

back to top
Libraries
Library NameType
Flavedo Maturecdna_library
Properties
Property NameValue
Genbank descriptionCSAF-PNP1244O22 Flavedo Mature Citrus sinensis cDNA clone CSAF-PNP1244O22 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403410 ID=DR403410|Name=DR403410|organism=Citrus sinensis|type=EST|length=308bp
GGGGGAGTTGAAGATGGTGTTCCATATTGGCTGATTAAGAACTCTTGGGG
AGAGAACTGGGGCGATCATGGCTACTTTAAGATGGAGATGGGGAAGAACA
TGTGTGGTATTGCAACTTGTGCATCATACCCAGTTGTGGCTTAGTCTGCT
CCTGAAGAAATAGTTGGATCTGGCTATCAGCAAGTCATTTGCTCATAAAA
CTTATATTATTTCACTCAAGAATGATAGCAGAATGGTTGGCTTTATGTAC
GAAATAAATTCGGAGATTAATGTCCATACGAAAAAAAAAAAAAAAAAAAA
AAAAAAAA
back to top