DR403408

Overview
NameDR403408
Unique NameDR403408
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length702
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DR403408_ssr540 microsatellite DR403408_ssr540:540..554. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DR403408 vs. ExPASy Swiss-Prot
Match: VP282_ARATH (Vacuolar protein sorting-associated protein 28 homolog 2 OS=Arabidopsis thaliana GN=VPS28-2 PE=1 SV=2)

HSP 1 Score: 242.276 bits (617), Expect = 1.932e-63
Identity = 122/163 (74.85%), Postives = 132/163 (80.98%), Query Frame = 1
Query:    4 ETECQKLIAHFKTLSSTLKDIVPSIERFADTYKMDCPAALNRLVTSGVPATVEHKXXXXXXXXXXXXXXXECVQNFITAMDSLKLNMVAVDQVHPXXXXXXXXXXXXTILPPDFEGKTKMKDWISRLSKMGAADELTEQQSRQLHFDLESSYNSFMAALPNAG 492
            E+ECQKLI HFKTLS+TLKD VP+IERFADTYKMDCPAAL RLVTSG+PATVEH+               ECVQNFIT+MDSLKLNMVAVDQV+P            +ILPPDFEGKTKMK+W+SRLSKMGAADELTEQQSRQLHFDLESSYNSFMAALP AG
Sbjct:   47 ESECQKLIVHFKTLSATLKDTVPNIERFADTYKMDCPAALYRLVTSGLPATVEHRATVAASTSNSASIVAECVQNFITSMDSLKLNMVAVDQVYPLLSDLSASLNKLSILPPDFEGKTKMKEWLSRLSKMGAADELTEQQSRQLHFDLESSYNSFMAALPKAG 209          
BLAST of DR403408 vs. ExPASy Swiss-Prot
Match: VP281_ARATH (Vacuolar protein sorting-associated protein 28 homolog 1 OS=Arabidopsis thaliana GN=VPS28-1 PE=1 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 6.871e-61
Identity = 117/163 (71.78%), Postives = 131/163 (80.37%), Query Frame = 1
Query:    4 ETECQKLIAHFKTLSSTLKDIVPSIERFADTYKMDCPAALNRLVTSGVPATVEHKXXXXXXXXXXXXXXXECVQNFITAMDSLKLNMVAVDQVHPXXXXXXXXXXXXTILPPDFEGKTKMKDWISRLSKMGAADELTEQQSRQLHFDLESSYNSFMAALPNAG 492
            ETECQKLI HFKTLS++LKD+VP+IERFA+TYKMDC AA+ RLVTSGVPATVEH+               ECVQNFIT+MDSLKLNMVAVDQV+P            +ILPPDFEGK KMK+W+ RLSKMGA+DELTEQQ+RQLHFDLESSYNSFMAALPNAG
Sbjct:   46 ETECQKLIVHFKTLSASLKDMVPNIERFAETYKMDCSAAVYRLVTSGVPATVEHRAAASASTSSSASVVAECVQNFITSMDSLKLNMVAVDQVYPLLSDLSASLNKLSILPPDFEGKIKMKEWLLRLSKMGASDELTEQQARQLHFDLESSYNSFMAALPNAG 208          
BLAST of DR403408 vs. ExPASy Swiss-Prot
Match: VPS28_DICDI (Vacuolar protein sorting-associated protein 28 OS=Dictyostelium discoideum GN=vps28 PE=3 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.070e-29
Identity = 69/158 (43.67%), Postives = 93/158 (58.86%), Query Frame = 1
Query:    7 TECQKLIAHFKTLSSTLKDIVPSIERFADTYKMDCPAALNRLVTSGVPATVEHKXXXXXXXXXXXXXXXECVQNFITAMDSLKLNMVAVDQVHPXXXXXXXXXXXXTILPPDFEGKTKMKDWISRLSKMGAADELTEQQSRQLHFDLESSYNSFMAAL 480
            T C KLIA FK+  + LKD V ++ +F   Y ++C AA +RLV  G P+T+EH                E VQ FIT MDS++L +V+VD ++P              L P FEGK K+K+WIS L++M A DEL + QSRQL FDL++SYN F  A+
Sbjct:  129 TACSKLIAQFKSSQTLLKDQVSNVGQFMKDYDLNCKAAFDRLVIKGFPSTLEHNTNESSTDSAMAKNVAEAVQLFITTMDSIRLKLVSVDGIYPLLSDLMESLNKNQWLGPTFEGKEKIKNWISILNQMKATDELDDDQSRQLLFDLDNSYNIFYKAI 286          
BLAST of DR403408 vs. ExPASy Swiss-Prot
Match: VPS28_YEAST (Vacuolar protein sorting-associated protein 28 OS=Saccharomyces cerevisiae GN=VPS28 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.193e-18
Identity = 65/172 (37.79%), Postives = 82/172 (47.67%), Query Frame = 1
Query:   19 KLIAHFKT-LSSTLKDIV----PSIERFADTYKMDCPAALNRLVTSGVPATVEH-------------KXXXXXXXXXXXXXXXECVQNFITAMDSLKLNMVAVDQVHPXXXXXXXXXXXXTILPPDFEGKTKMKDWISRLSKMGAADELTEQQSRQLHFDLESSYNSFMAAL 480
            KL+  FK  L+S  K+ +     SIE F DTY +    A+ RL   G+P T EH             K               E   NFIT MD+LKLN  A DQ+HP            T    DFE ++K+ DWI R++K+   D LTE Q R+L FDLE +Y SF A L
Sbjct:   73 KLLKQFKVYLNSQNKEEINKHFQSIEAFCDTYNITASNAITRL-ERGIPITAEHAISTTTSAPSGDNKQSSSSDKKFNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVT--RDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALL 241          
BLAST of DR403408 vs. ExPASy Swiss-Prot
Match: VPS28_CAEEL (Vacuolar protein sorting-associated protein 28 homolog OS=Caenorhabditis elegans GN=Y87G2A.10 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.193e-18
Identity = 57/159 (35.85%), Postives = 86/159 (54.09%), Query Frame = 1
Query:    4 ETECQKLIAHFKTLSSTLKDIVPSIERFADTYKMDCPAALNRLVTSGVPATVEHKXXXXXXXXXXXXXXXECVQNFITAMDSLKLNMVAVDQVHPXXXXXXXXXXXXTILPPDFEGKTKMKDWISRLSKMGAADELTEQQSRQLHFDLESSYNSFMAAL 480
            ++EC KLI  +K ++  L     SIE FA  Y++ CPAA+ R +  G P TV+                   V+ FIT +D+L+LN  AVD ++P            + +P D    TK+K W  RLS M A+DE++++ +RQ+ FD+ES+Y +F  AL
Sbjct:   55 KSECFKLIDQYK-VTMRLVHGATSIEDFAKKYRLHCPAAIER-IREGRPITVKDDQGNVLKHIA------SIVEQFITFLDALRLNTRAVDDLYPGLDDLYNAINTTSRVPIDAIVTTKVKKWHDRLSSMAASDEISDEDARQMIFDVESAYQAFNKAL 205          
BLAST of DR403408 vs. ExPASy Swiss-Prot
Match: VPS28_RAT (Vacuolar protein sorting-associated protein 28 homolog OS=Rattus norvegicus GN=Vps28 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.395e-18
Identity = 50/153 (32.68%), Postives = 79/153 (51.63%), Query Frame = 1
Query:   13 CQKLIAHFKTLSSTLKDI-VPSIERFADTYKMDCPAALNRLVTSGVPATVEHKXXXXXXXXXXXXXXXECVQNFITAMDSLKLNMVAVDQVHPXXXXXXXXXXXXTILPPDFEGKTKMKDWISRLSKMGAADELTEQQSRQLHFDLESSYNSF 468
            C +L+  +K     ++   + SI+ F   +++DCP A+ R +    P T++                 + V  FIT MD L+L + A+D++ P            + LPPDFEG+  +  W+  LS M A+DEL + Q RQ+ FDLES+YN+F
Sbjct:   77 CSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMER-IKEDRPITIKDDKGNLNRCIA------DVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAF 222          
BLAST of DR403408 vs. ExPASy Swiss-Prot
Match: VPS28_MOUSE (Vacuolar protein sorting-associated protein 28 homolog OS=Mus musculus GN=Vps28 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.395e-18
Identity = 50/153 (32.68%), Postives = 79/153 (51.63%), Query Frame = 1
Query:   13 CQKLIAHFKTLSSTLKDI-VPSIERFADTYKMDCPAALNRLVTSGVPATVEHKXXXXXXXXXXXXXXXECVQNFITAMDSLKLNMVAVDQVHPXXXXXXXXXXXXTILPPDFEGKTKMKDWISRLSKMGAADELTEQQSRQLHFDLESSYNSF 468
            C +L+  +K     ++   + SI+ F   +++DCP A+ R +    P T++                 + V  FIT MD L+L + A+D++ P            + LPPDFEG+  +  W+  LS M A+DEL + Q RQ+ FDLES+YN+F
Sbjct:   70 CSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMER-IKEDRPITIKDDKGNLNRCIA------DVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAF 215          
BLAST of DR403408 vs. ExPASy Swiss-Prot
Match: VPS28_HUMAN (Vacuolar protein sorting-associated protein 28 homolog OS=Homo sapiens GN=VPS28 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.395e-18
Identity = 50/153 (32.68%), Postives = 79/153 (51.63%), Query Frame = 1
Query:   13 CQKLIAHFKTLSSTLKDI-VPSIERFADTYKMDCPAALNRLVTSGVPATVEHKXXXXXXXXXXXXXXXECVQNFITAMDSLKLNMVAVDQVHPXXXXXXXXXXXXTILPPDFEGKTKMKDWISRLSKMGAADELTEQQSRQLHFDLESSYNSF 468
            C +L+  +K     ++   + SI+ F   +++DCP A+ R +    P T++                 + V  FIT MD L+L + A+D++ P            + LPPDFEG+  +  W+  LS M A+DEL + Q RQ+ FDLES+YN+F
Sbjct:   70 CSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMER-IKEDRPITIKDDKGNLNRCIA------DVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAF 215          
BLAST of DR403408 vs. ExPASy Swiss-Prot
Match: VPS28_BOVIN (Vacuolar protein sorting-associated protein 28 homolog OS=Bos taurus GN=VPS28 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.395e-18
Identity = 50/153 (32.68%), Postives = 79/153 (51.63%), Query Frame = 1
Query:   13 CQKLIAHFKTLSSTLKDI-VPSIERFADTYKMDCPAALNRLVTSGVPATVEHKXXXXXXXXXXXXXXXECVQNFITAMDSLKLNMVAVDQVHPXXXXXXXXXXXXTILPPDFEGKTKMKDWISRLSKMGAADELTEQQSRQLHFDLESSYNSF 468
            C +L+  +K     ++   + SI+ F   +++DCP A+ R +    P T++                 + V  FIT MD L+L + A+D++ P            + LPPDFEG+  +  W+  LS M A+DEL + Q RQ+ FDLES+YN+F
Sbjct:   70 CSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMER-IKEDRPITIKDDKGNLNRCIA------DVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAF 215          
BLAST of DR403408 vs. ExPASy Swiss-Prot
Match: VPS28_DROME (Vacuolar protein sorting-associated protein 28 homolog OS=Drosophila melanogaster GN=Vps28 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.570e-17
Identity = 51/153 (33.33%), Postives = 77/153 (50.33%), Query Frame = 1
Query:   13 CQKLIAHFKTLSSTLK-DIVPSIERFADTYKMDCPAALNRLVTSGVPATVEHKXXXXXXXXXXXXXXXECVQNFITAMDSLKLNMVAVDQVHPXXXXXXXXXXXXTILPPDFEGKTKMKDWISRLSKMGAADELTEQQSRQLHFDLESSYNSF 468
            C K +  +K     ++ D  PS+E F   +++DCPAAL R +    P T+                  E V  FIT MD L+L +  +D + P            +++P DF+ K K++ W+  L++M A+DEL+E Q RQ  FDLES+Y  F
Sbjct:   58 CSKYLVQYKVAFKQVQCDEFPSVETFVKKFRLDCPAALER-IREDRPITIRDDKGNTSKCIA------EIVSLFITIMDKLRLQINTMDALQPDVKDLADNMNRLSLIPEDFDAKLKVEKWLGSLNEMQASDELSEGQVRQFLFDLESAYADF 203          
The following BLAST results are available for this feature:
BLAST of DR403408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
VP282_ARATH1.932e-6374.85Vacuolar protein sorting-associated protein 28 hom... [more]
VP281_ARATH6.871e-6171.78Vacuolar protein sorting-associated protein 28 hom... [more]
VPS28_DICDI1.070e-2943.67Vacuolar protein sorting-associated protein 28 OS=... [more]
VPS28_YEAST7.193e-1837.79Vacuolar protein sorting-associated protein 28 OS=... [more]
VPS28_CAEEL7.193e-1835.85Vacuolar protein sorting-associated protein 28 hom... [more]
VPS28_RAT9.395e-1832.68Vacuolar protein sorting-associated protein 28 hom... [more]
VPS28_MOUSE9.395e-1832.68Vacuolar protein sorting-associated protein 28 hom... [more]
VPS28_HUMAN9.395e-1832.68Vacuolar protein sorting-associated protein 28 hom... [more]
VPS28_BOVIN9.395e-1832.68Vacuolar protein sorting-associated protein 28 hom... [more]
VPS28_DROME3.570e-1733.33Vacuolar protein sorting-associated protein 28 hom... [more]
back to top
Libraries
Library NameType
Flavedo Maturecdna_library
Properties
Property NameValue
Genbank descriptionCSAF-PNP1244O17 Flavedo Mature Citrus sinensis cDNA clone CSAF-PNP1244O17 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403408 ID=DR403408|Name=DR403408|organism=Citrus sinensis|type=EST|length=702bp
GGGGAAACAGAATGTCAAAAGCTCATTGCCCATTTTAAAACCTTATCTTC
GACCTTGAAAGATATTGTTCCCAGCATTGAACGGTTTGCTGATACATATA
AAATGGACTGTCCGGCTGCTCTGAATCGCTTGGTCACCTCTGGGGTGCCT
GCTACGGTGGAGCATAAAGCGGCTGCAGTTGCCTCAACCACCACCTCTGC
TGCCATTGTGGCAGAGTGTGTCCAGAACTTTATTACTGCCATGGACTCTT
TAAAATTGAATATGGTGGCAGTTGATCAGGTGCATCCGCTGTTATCAGAT
TTGCTGGGTTCACTCAATAAGCTGACTATTCTGCCACCGGATTTTGAGGG
GAAAACTAAAATGAAGGACTGGATTTCAAGGTTGTCAAAGATGGGTGCTG
CAGATGAGTTGACCGAGCAGCAGTCCCGGCAACTTCACTTTGACCTTGAA
TCCTCATACAACTCATTCATGGCAGCTCTTCCTAATGCTGGTACTTAAAT
TGATGATTTAGGTAAGCTTGTAAGGATTATCAAGCATAGTTGTTTTGTTT
TGTTGATTTCATATATAAGATAGTTTGTTGTTTGAACCTCATTGATGAGT
GATAACTTGGAAGGATTCTTATTAATTTTGTAATTGCTTATAAATTTGAG
GGATATGACTGCATTATTGTACTGAAAAATTNNNNNTTTGTGCTGATCTC
GA
back to top