DR403404

Overview
NameDR403404
Unique NameDR403404
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length624
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DR403404 vs. ExPASy Swiss-Prot
Match: METK3_CATRO (S-adenosylmethionine synthetase 3 OS=Catharanthus roseus GN=SAMS3 PE=1 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 2.328e-96
Identity = 178/207 (85.99%), Postives = 185/207 (89.37%), Query Frame = 2
Query:    2 PELMPLTLVLATKLGARLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPQRVHTVLISTQHDETVTKEQISEDLKEHVIKPVIPAHFLDERTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDSTKVDRSAAYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYGTGKISDKDILALIKENF 622
            PELMPLT VLATKLGA+LTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVP RVHTVLISTQHDETVT EQI++DLKEHVIKPVIPA +LD++TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY             KD TKVDRS AYIVRQAAKSVVASGLARRCLVQVSYAIGV EPLSVFVDT+ TGKI DKDILALIKENF
Sbjct:  135 PELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPIRVHTVLISTQHDETVTNEQIAQDLKEHVIKPVIPAQYLDDQTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCLVQVSYAIGVAEPLSVFVDTFKTGKIPDKDILALIKENF 341          
BLAST of DR403404 vs. ExPASy Swiss-Prot
Match: METK2_ACTCH (S-adenosylmethionine synthetase 2 OS=Actinidia chinensis GN=SAM2 PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 3.041e-96
Identity = 176/207 (85.02%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 PELMPLTLVLATKLGARLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPQRVHTVLISTQHDETVTKEQISEDLKEHVIKPVIPAHFLDERTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDSTKVDRSAAYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYGTGKISDKDILALIKENF 622
            PELMPLT VLATKLGA+LTEVRKN TCPWLRPDGKTQVTVEYRNEGGAMVP RVHTVLISTQHDETVT EQI++DLKEHVIKPVIPA ++D+ TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY             KD TKVDRS AY+VRQAAKSVVASGLARRC+VQVSYAIGVPEPLSVFVDTY TGKI DKDILALIKENF
Sbjct:  135 PELMPLTHVLATKLGAKLTEVRKNNTCPWLRPDGKTQVTVEYRNEGGAMVPVRVHTVLISTQHDETVTNEQIAKDLKEHVIKPVIPAQYMDDDTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYVVRQAAKSVVASGLARRCIVQVSYAIGVPEPLSVFVDTYKTGKIPDKDILALIKENF 341          
BLAST of DR403404 vs. ExPASy Swiss-Prot
Match: METK3_VITVI (S-adenosylmethionine synthetase 3 OS=Vitis vinifera GN=METK3 PE=3 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 1.509e-95
Identity = 175/207 (84.54%), Postives = 185/207 (89.37%), Query Frame = 2
Query:    2 PELMPLTLVLATKLGARLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPQRVHTVLISTQHDETVTKEQISEDLKEHVIKPVIPAHFLDERTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDSTKVDRSAAYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYGTGKISDKDILALIKENF 622
            PELMPLT VLATKLGA+LTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVP RVHTVLISTQHDETVT +QI+++L+EHVIKPVIP+ F+D++TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY             KD TKVDRS AYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTY TGKI DKDIL LIKENF
Sbjct:  135 PELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPIRVHTVLISTQHDETVTNDQIAKELREHVIKPVIPSKFMDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYKTGKIPDKDILDLIKENF 341          
BLAST of DR403404 vs. ExPASy Swiss-Prot
Match: METK1_VITVI (S-adenosylmethionine synthetase 1 OS=Vitis vinifera GN=METK1 PE=3 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 1.971e-95
Identity = 175/207 (84.54%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 PELMPLTLVLATKLGARLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPQRVHTVLISTQHDETVTKEQISEDLKEHVIKPVIPAHFLDERTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDSTKVDRSAAYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYGTGKISDKDILALIKENF 622
            PELMPLT VLATKLGA+LTEVRKN TCPWLRPDGKTQVTVEYRNEGGAMVP RVHTVL+STQHDETVT EQI++DLKEHVIKPVIP  +LD++TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY             KD TKVDRS AYIVRQAAKSVVASGLARRC+VQVSYAIGVPEPLSVFVDTY TGKI DKDILALIK+NF
Sbjct:  135 PELMPLTHVLATKLGAKLTEVRKNGTCPWLRPDGKTQVTVEYRNEGGAMVPIRVHTVLVSTQHDETVTNEQIAKDLKEHVIKPVIPPQYLDDQTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVPEPLSVFVDTYKTGKIPDKDILALIKKNF 341          
BLAST of DR403404 vs. ExPASy Swiss-Prot
Match: METK1_ACTCH (S-adenosylmethionine synthetase 1 OS=Actinidia chinensis GN=SAM1 PE=2 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 3.362e-95
Identity = 175/207 (84.54%), Postives = 183/207 (88.41%), Query Frame = 2
Query:    2 PELMPLTLVLATKLGARLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPQRVHTVLISTQHDETVTKEQISEDLKEHVIKPVIPAHFLDERTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDSTKVDRSAAYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYGTGKISDKDILALIKENF 622
            PELMPLT VLATKLGA+LTEVRKN TCPWLRPDGKTQVTVEYRNEGGAMVP RVHTVLISTQHDETVT +QI+ DLK+HVIKPV+PA +LD+ TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY             KD TKVDRS AYIVRQAAKSVVASGLARRCLVQVSYAIGV EPLSVFVDTY TGKI+DKDILALIKENF
Sbjct:  135 PELMPLTHVLATKLGAKLTEVRKNSTCPWLRPDGKTQVTVEYRNEGGAMVPIRVHTVLISTQHDETVTNDQIANDLKKHVIKPVVPAQYLDDNTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCLVQVSYAIGVAEPLSVFVDTYKTGKIADKDILALIKENF 341          
BLAST of DR403404 vs. ExPASy Swiss-Prot
Match: METK4_POPTR (S-adenosylmethionine synthetase 4 OS=Populus trichocarpa GN=METK4 PE=2 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 7.489e-95
Identity = 173/207 (83.57%), Postives = 182/207 (87.92%), Query Frame = 2
Query:    2 PELMPLTLVLATKLGARLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPQRVHTVLISTQHDETVTKEQISEDLKEHVIKPVIPAHFLDERTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDSTKVDRSAAYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYGTGKISDKDILALIKENF 622
            PELMPLT VLATKLGA+LTEVRKNKTCPWLRPDGKTQVTVEY+NEGGAMVP RVHT+LISTQHDE VT EQI+ DLKEHVIKPVIP  +LD++TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY             KD TKVDRS AYIVRQAAKSVVASGLARRC+VQVSYAIGVPEPLSVFVDTY TGKI D+DIL LIKENF
Sbjct:  135 PELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEGGAMVPIRVHTILISTQHDENVTNEQIAADLKEHVIKPVIPVQYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVPEPLSVFVDTYKTGKIPDRDILELIKENF 341          
BLAST of DR403404 vs. ExPASy Swiss-Prot
Match: METK2_PICSI (S-adenosylmethionine synthetase 2 OS=Picea sitchensis GN=METK2 PE=2 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 1.277e-94
Identity = 172/207 (83.09%), Postives = 182/207 (87.92%), Query Frame = 2
Query:    2 PELMPLTLVLATKLGARLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPQRVHTVLISTQHDETVTKEQISEDLKEHVIKPVIPAHFLDERTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDSTKVDRSAAYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYGTGKISDKDILALIKENF 622
            PELMPLT VLATKLGA+LTEVRKN TCPWLRPDGKTQVT+EYRNEGGAMVP+RVHTVLISTQHDETVT +QI+ DLKEHVIKPVIP  +LDE TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY             KD TKVDRS AYIVRQAAKS+VA+GLARRCLVQVSYAIGVPEPLSVFVD+YGTG I DK+IL LIKENF
Sbjct:  135 PELMPLTHVLATKLGAKLTEVRKNGTCPWLRPDGKTQVTIEYRNEGGAMVPERVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPEKYLDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVAAGLARRCLVQVSYAIGVPEPLSVFVDSYGTGSIPDKEILELIKENF 341          
BLAST of DR403404 vs. ExPASy Swiss-Prot
Match: METK_DENCR (S-adenosylmethionine synthetase OS=Dendrobium crumenatum GN=SAMS PE=2 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 3.717e-94
Identity = 170/207 (82.13%), Postives = 183/207 (88.41%), Query Frame = 2
Query:    2 PELMPLTLVLATKLGARLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPQRVHTVLISTQHDETVTKEQISEDLKEHVIKPVIPAHFLDERTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDSTKVDRSAAYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYGTGKISDKDILALIKENF 622
            PELMPL+ VLATKLGARLTEVRKN TCPWLRPDGKTQVTVEYRN+GGAMVP RVHTVLISTQHDETVT ++I+ DLKEHVIKPV+P  +LDE+TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY             KD TKVDRS AYIVRQAAKSVVA+GLARRC+VQVSYAIGVPEPLSVFVDTYGTGKI DK+IL ++KENF
Sbjct:  138 PELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYRNDGGAMVPIRVHTVLISTQHDETVTNDEIAADLKEHVIKPVVPEQYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENF 344          
BLAST of DR403404 vs. ExPASy Swiss-Prot
Match: METK3_SOLLC (S-adenosylmethionine synthetase 3 OS=Solanum lycopersicum GN=SAM3 PE=2 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 8.280e-94
Identity = 173/207 (83.57%), Postives = 181/207 (87.44%), Query Frame = 2
Query:    2 PELMPLTLVLATKLGARLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPQRVHTVLISTQHDETVTKEQISEDLKEHVIKPVIPAHFLDERTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDSTKVDRSAAYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYGTGKISDKDILALIKENF 622
            PELMPLT VLATKLGA+LTEVRKNKTCPWLRPDGKTQVTVEY+N+ GAMVP RVHTVLISTQHDETVT +QI++DLKEHVIKPVIPA +LDE TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY             KD TKVDRS AYIVRQAAKSVVASGLARRC+VQVSYAIGV EPLSVFVDTY TG I DKDIL LIKENF
Sbjct:  135 PELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDNGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILVLIKENF 341          
BLAST of DR403404 vs. ExPASy Swiss-Prot
Match: METK2_SOLTU (S-adenosylmethionine synthetase 2 OS=Solanum tuberosum GN=METK2 PE=2 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 8.280e-94
Identity = 173/207 (83.57%), Postives = 181/207 (87.44%), Query Frame = 2
Query:    2 PELMPLTLVLATKLGARLTEVRKNKTCPWLRPDGKTQVTVEYRNEGGAMVPQRVHTVLISTQHDETVTKEQISEDLKEHVIKPVIPAHFLDERTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXXKDSTKVDRSAAYIVRQAAKSVVASGLARRCLVQVSYAIGVPEPLSVFVDTYGTGKISDKDILALIKENF 622
            PELMPLT VLATKLGA+LTEVRKNKTCPWLRPDGKTQVTVEY+N+ GAMVP RVHTVLISTQHDETVT +QI++DLKEHVIKPVIPA +LDE TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY             KD TKVDRS AYIVRQAAKSVVASGLARRC+VQVSYAIGV EPLSVFVDTY TG I DKDIL LIKENF
Sbjct:  135 PELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDNGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILVLIKENF 341          
The following BLAST results are available for this feature:
BLAST of DR403404 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK3_CATRO2.328e-9685.99S-adenosylmethionine synthetase 3 OS=Catharanthus ... [more]
METK2_ACTCH3.041e-9685.02S-adenosylmethionine synthetase 2 OS=Actinidia chi... [more]
METK3_VITVI1.509e-9584.54S-adenosylmethionine synthetase 3 OS=Vitis vinifer... [more]
METK1_VITVI1.971e-9584.54S-adenosylmethionine synthetase 1 OS=Vitis vinifer... [more]
METK1_ACTCH3.362e-9584.54S-adenosylmethionine synthetase 1 OS=Actinidia chi... [more]
METK4_POPTR7.489e-9583.57S-adenosylmethionine synthetase 4 OS=Populus trich... [more]
METK2_PICSI1.277e-9483.09S-adenosylmethionine synthetase 2 OS=Picea sitchen... [more]
METK_DENCR3.717e-9482.13S-adenosylmethionine synthetase OS=Dendrobium crum... [more]
METK3_SOLLC8.280e-9483.57S-adenosylmethionine synthetase 3 OS=Solanum lycop... [more]
METK2_SOLTU8.280e-9483.57S-adenosylmethionine synthetase 2 OS=Solanum tuber... [more]

Pages

back to top
Libraries
Library NameType
Flavedo Maturecdna_library
Properties
Property NameValue
Genbank descriptionCSAF-PNP1244O13 Flavedo Mature Citrus sinensis cDNA clone CSAF-PNP1244O13 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403404 ID=DR403404|Name=DR403404|organism=Citrus sinensis|type=EST|length=624bp
ACCTGAGCTAATGCCGCTGACTCTCGTTCTTGCCACCAAGCTTGGAGCCA
GACTTACTGAGGTGAGAAAGAATAAGACATGCCCCTGGCTGAGGCCGGAT
GGAAAAACCCAGGTGACTGTTGAGTACCGGAACGAAGGTGGAGCCATGGT
CCCACAGAGGGTCCACACTGTTCTCATTTCAACCCAGCACGATGAAACTG
TCACCAAGGAGCAGATTTCTGAGGACCTGAAGGAGCATGTGATTAAACCA
GTCATTCCGGCACATTTCCTTGATGAAAGGACAATCTTCCACCTCAACCC
CTCTGGTCGTTTTGTCATTGGCGGGCCACATGGGGATGCAGGGCTTACCG
GTAGGAAGATCATCATTGATACTTATGGTGGTTGGGGTGCTCATGGTGGC
GGTGCCTTCTCTGGCAAGGATTCTACAAAGGTCGATCGAAGTGCTGCATA
TATTGTCAGGCAGGCTGCAAAGAGTGTGGTGGCTTCTGGGCTTGCCCGTC
GCTGTCTTGTCCAGGTCTCTTATGCCATTGGTGTGCCAGAACCGCTGTCT
GTGTTTGTGGACACTTATGGTACAGGAAAGATTTCAGATAAGGATATACT
GGCTCTAATTAAGGAGAACTTTGA
back to top