EY701053
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY701053 vs. ExPASy Swiss-Prot
Match: FB233_ARATH (F-box protein At4g12560 OS=Arabidopsis thaliana GN=At4g12560 PE=2 SV=2) HSP 1 Score: 71.633 bits (174), Expect = 3.009e-15 Identity = 41/129 (31.78%), Postives = 72/129 (55.81%), Query Frame = 3 Query: 249 KPLLRFRCVSKCFCSLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMSNRRLXMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGV 635 K L+R R +SK LI+ DF++ HL++ ++T L ++ L + +S++LDS+D+ ++E+P K+ G T V G +GL+ +SN ++VFNP+T++ P D T + F G+ Sbjct: 19 KTLVRCRALSKPCYHLINDPDFIESHLHRVLQTGDHLMIL---LRGALRLYSVDLDSLDSVSDVEHPMKR--GGPTEVFGSSNGLIGLSNSPTDLAVFNPSTRQIHRLPPSSIDLPDGSSTRGYVFYGL 142 HSP 2 Score: 31.5722 bits (70), Expect = 3.009e-15 Identity = 15/50 (30.00%), Postives = 29/50 (58.00%), Query Frame = 1 Query: 631 GCGYDASTDDYNLVGIIQSYEVDE---------LEGVIYSLRAETWRRTQ 753 G GYD+ +DDY +V ++Q +++D E ++SL+ +W+R + Sbjct: 141 GLGYDSVSDDYKVVRMVQ-FKIDSEDELGCSFPYEVKVFSLKKNSWKRIE 189
BLAST of EY701053 vs. ExPASy Swiss-Prot
Match: FB244_ARATH (F-box protein At4g22390 OS=Arabidopsis thaliana GN=At4g22390 PE=2 SV=3) HSP 1 Score: 62.3882 bits (150), Expect = 1.685e-11 Identity = 36/107 (33.64%), Postives = 60/107 (56.07%), Query Frame = 3 Query: 255 LLRFRCVSKCFCSLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMSNRRLXMSVFNPTTKKFKLFP 575 L++ R +SK SLIDS +FV HL + +ET L ++ L ++ELDS +N +I +P + G T V G +G++ + N + +++FNP+T+K P Sbjct: 21 LVKCRVLSKPCFSLIDSPEFVSSHLRRRLETGEHLMIL---LRGPRLLRTVELDSPENVSDIPHPLQA--GGFTEVFGSFNGVIGLCNSPVDLAIFNPSTRKIHRLP 122 HSP 2 Score: 28.1054 bits (61), Expect = 1.685e-11 Identity = 14/46 (30.43%), Postives = 25/46 (54.35%), Query Frame = 1 Query: 631 GCGYDASTDDYNLVGIIQSYEVD-------ELEGVIYSLRAETWRR 747 G GYD+ DD+ +V I+Q + +E ++SL+ +W+R Sbjct: 141 GLGYDSVGDDFKVVRIVQCKLKEGKKKFPCPVEVKVFSLKKNSWKR 186 The following BLAST results are available for this feature:
BLAST of EY701053 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY701053 ID=EY701053; Name=EY701053; organism=Citrus sinensis; type=EST; length=868bpback to top |