CX046742

Overview
NameCX046742
Unique NameCX046742
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length796
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3804 contig Csv1_Contig3804:1..796. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX046742 vs. ExPASy Swiss-Prot
Match: Y1821_SYNY3 (Putative zinc metalloprotease slr1821 OS=Synechocystis sp. (strain PCC 6803) GN=slr1821 PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 8.219e-40
Identity = 84/158 (53.16%), Postives = 105/158 (66.46%), Query Frame = 1
Query:  301 SVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSIRAFPLGGFVGFPDNDPESGIPVDDENLLKNRPILDRVIVISXXXXXXXXXXXXXXXTQVLSVGLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILSVNGNEFP 774
            + L A GVL  +I VHE GHF AA LQGIHV++FA+GFGP L K+     EYSIRA PLGG+V FPD+DP+S IP DD NLLKNRPILDR IVIS                QV ++G   Q+  PG+++P+V + SAA   G+ PGD++LS+ GN  P
Sbjct:    5 AALAAIGVLAVLIAVHELGHFAAARLQGIHVTRFALGFGPPLLKYQGAETEYSIRAIPLGGYVAFPDDDPDSEIPADDPNLLKNRPILDRAIVISAGVIANLVFAYFLLIGQVSTIGF--QNIQPGLVIPQVDSASAAQVAGMEPGDIVLSLQGNTLP 160          
BLAST of CX046742 vs. ExPASy Swiss-Prot
Match: Y3971_ANASP (Putative zinc metalloprotease all3971 OS=Anabaena sp. (strain PCC 7120) GN=all3971 PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.005e-37
Identity = 89/161 (55.28%), Postives = 107/161 (66.46%), Query Frame = 1
Query:  301 SVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSIRAFPLGGFVGFPDNDPESGIPVDDENLLKNRPILDRVIVISXXXXXXXXXXXXXXXTQVLSVGLPVQDAFPGV----LVPEVRALSAASRDGLFPGDVILSVNGNEF 771
            SVL A  VL  +I+VHE GHF+AA  QGIHV++F++GFGP+L K+     EY+IRAFPLGGFVGFPD+DP+S IP +D NLL+NRPILDR IVIS                QV  VG+  Q + PGV    L PEV A+  A+  GL PGDVILS N  EF
Sbjct:    2 SVLAAIAVLAVLILVHELGHFVAARSQGIHVNRFSLGFGPVLWKYQGAETEYAIRAFPLGGFVGFPDDDPDSDIPPNDPNLLRNRPILDRAIVISAGVIANLIFAYMLLLAQVGFVGIG-QASQPGVSIQQLAPEVSAV--ATNAGLKPGDVILSANQKEF 159          
BLAST of CX046742 vs. ExPASy Swiss-Prot
Match: Y1693_CLOPE (Putative zinc metalloprotease CPE1693 OS=Clostridium perfringens GN=CPE1693 PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.477e-14
Identity = 49/159 (30.82%), Postives = 74/159 (46.54%), Query Frame = 1
Query:  304 VLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSIRAFPLGGFVGFPDNDPESGIPVDDENLLKNRPILDRVIVISXXXXXXXXXXXXXXXTQVLSVGLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKT 780
            ++ A    +A+I+VHE GHF+ A L GI+V +FA+G GP L        EY++R  P GGFV     + ES    DD   L  +  + R++V+                  ++ +GL +   F    V  V   S A   G+  GD  L ++GN+   T
Sbjct:    3 IIFALLAFSALILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGETEYNLRILPFGGFVKMLGEEDES----DDSRSLNAKTPIQRILVMG------AGAFMNYVLALIIFIGLAMSSGFAENKVASVVPNSPAQEIGIEQGDEFLKIDGNKIHTT 151          
BLAST of CX046742 vs. ExPASy Swiss-Prot
Match: Y1796_CLOAB (Putative zinc metalloprotease CA_C1796 OS=Clostridium acetobutylicum GN=CA_C1796 PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.138e-11
Identity = 45/156 (28.85%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  292 SFESVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSIRAFPLGGFVGFPDNDPESGIPVDDENLLKNRPILDRVIVISXXXXXXXXXXXXXXXTQVLSVGLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILSVN 759
            SF +++ A      +I++HE GHF+ A L  + V +FA+G GP L        +YSIRA P+GG+V    ++ +S    DD     N+    R+ ++                   +S G+    A P   V ++ A S A + G+  GD I+ +N
Sbjct:    2 SFFNIVIAILAFGVLILIHELGHFVLAKLNDVKVEEFAIGMGPKLLGIKGKETQYSIRALPIGGYVKMLGDESKS----DDPRAFNNKSSARRLSIVIAGPIMNLILAAVLFCIVGMSEGI----ALP--TVGKISANSPAQKIGIKAGDTIVKIN 147          
The following BLAST results are available for this feature:
BLAST of CX046742 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
Y1821_SYNY38.219e-4053.16Putative zinc metalloprotease slr1821 OS=Synechocy... [more]
Y3971_ANASP1.005e-3755.28Putative zinc metalloprotease all3971 OS=Anabaena ... [more]
Y1693_CLOPE3.477e-1430.82Putative zinc metalloprotease CPE1693 OS=Clostridi... [more]
Y1796_CLOAB6.138e-1128.85Putative zinc metalloprotease CA_C1796 OS=Clostrid... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_9H10_g Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-9H10-P19-1-6.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX046742 ID=CX046742|Name=CX046742|organism=Citrus sinensis|type=EST|length=796bp
TACACTCTCATCCTTTTCTTCTTCAAAAAAACAGATACCATGCTAATAAA
TTTCTCAACCTCCCCTCCATCTTCTTATTCTCTTATCAAAATTTCCAATT
CGAAGTTGCCCATCTCAGAATTCCCTCTCAAACCCAAAATCCATCTCTCA
AAATCTCATTTTTCTTGTGCTTGTTCTTCGTCAAGCCTCAGTTTTTATTG
CAAGAACCAATTATTTTATGAAAAGAGCAAGTACCCATTTCGGAAAAGAC
TTAATTTCAGGACGTGTGCTGTTTCGGGATTTGATTTGGGGAGTTTTGAA
TCTGTTCTGGAGGCAGCTGGAGTGTTGACAGCTATTATCATTGTTCATGA
AAGTGGTCACTTTCTTGCTGCCTATCTTCAAGGAATTCATGTAAGTAAAT
TTGCAGTTGGTTTTGGTCCAATTTTAGCTAAATTCAGTGCAAACAATGTA
GAGTACTCTATTAGAGCTTTTCCTTTAGGTGGATTTGTTGGGTTTCCTGA
TAATGATCCAGAGAGTGGCATTCCTGTTGATGATGAAAATTTACTTAAGA
ATCGGCCAATATTAGATAGGGTCATTGTGATATCAGCTGGTGTAGTAGCA
AATATAGTCTTTGCATTTGTGATAATCTTTACTCAGGTATTATCAGTTGG
TTTGCCTGTTCAAGATGCCTTTCCCGGGGTTCTTGTGCCTGAAGTTCGAG
CCCTTTCAGCTGCCTCTCGAGATGGATTGTTTCCTGGTGATGTAATCCTC
TCAGTTAACGGTAATGAATTCCCAAAAACTGGTCCAAATGTGGTCT
back to top